| PDBID: | 9gk5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkb | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9gk7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gka | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gjz | | Status: | HOLD -- hold until a certain date | | Title: | Ntaya methyltransferase (MTase) bound to AT-9010 (2''-methyl-2''-fluoro GTP) | | Authors: | Boura, E., Krejcova, K. | | Deposition date: | 2024-08-23 | | Release date: | 2024-10-18 |
|
| PDBID: | 9gk3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkf | | Status: | HPUB -- hold until publication | | Title: | Amyloid Fibril of Heterogeneous nuclear ribonucleoprotein A1A induced by RNA binding | | Authors: | Frey, L., Riek, R.P., Arosio, P., Morelli, C. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gjy | | Status: | HPUB -- hold until publication | | Title: | Bacillus licheniformis nitroreductase | | Authors: | Crennell, S.J., Danson, M.J., Emptage, C. | | Deposition date: | 2024-08-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMTEQSKKQEILDAFQFRHATKEFDPDRKISDEDFQFILEAGRLSPSSVGLEPWQFVVVQNKELREKLRQVSWGAQGQLPTASHFVLLLGRTAKEMRRDSGYVADQLKHVKKMPEDIIENMLKEDGVLESFQDGDFHLYESDRAMFDWVSKQTYIALANMMTAAALIGIDSCPIEGFNYDKVHDILEKEGVLEDGRFDISVMAAFGYRVKEPRPKTRRALDQIVKWVE
|
|
| PDBID: | 9gjx | | Status: | HPUB -- hold until publication | | Title: | Bacillus licheniformis nitroreductase | | Authors: | Crennell, S.J., Danson, M.J., Emptage, C. | | Deposition date: | 2024-08-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMTEQSKKQEILDAFQFRHATKEFDPDRKISDEDFQFILEAGRLSPSSVGLEPWQFVVVQNKELREKLRQVSWGAQGQLPTASHFVLLLGRTAKEMRRDSGYVADQLKHVKKMPEDIIENMLKEDGVLESFQDGDFHLYESDRAMFDWVSKQTYIALANMMTAAALIGIDSCPIEGFNYDKVHDILEKEGVLEDGRFDISVMAAFGYRVKEPRPKTRRALDQIVKWVE
|
|
| PDBID: | 9gk0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9j94 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-22 | | Release date: | 2026-02-22 |
|
| PDBID: | 9j93 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-22 | | Release date: | 2026-02-22 |
|
| PDBID: | 9j92 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-22 | | Release date: | 2026-02-22 |
|
| PDBID: | 9j95 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-22 | | Release date: | 2026-02-22 |
|
| PDBID: | 9j9e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-22 |
|
| PDBID: | 9j9f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-22 |
|
| PDBID: | 9j9g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-22 |
|
| PDBID: | 9j99 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-08-22 | | Release date: | 2025-08-22 |
|
| PDBID: | 9j9b | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-08-22 | | Release date: | 2025-08-22 |
|
| PDBID: | 9j96 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-22 |
|
| PDBID: | 9dae | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-22 |
|
