| PDBID: | 9db8 | | Status: | HPUB -- hold until publication | | Title: | Cu-Bound Structure of Computationally Designed Homotrimer Tet4 | | Authors: | Hoffnagle, A.M., Tezcan, F.A. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9db9 | | Status: | HPUB -- hold until publication | | Title: | Ni-Bound Structure of Computationally Designed Homotrimer Tet4 | | Authors: | Hoffnagle, A.M., Tezcan, F.A. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dba | | Status: | HPUB -- hold until publication | | Title: | Co-Bound Structure of Computationally Designed Homotrimer Tet4 | | Authors: | Hoffnagle, A.M., Tezcan, F.A. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbb | | Status: | HPUB -- hold until publication | | Title: | Fe-Bound Structure of Computationally Designed Homotrimer Tet4 | | Authors: | Hoffnagle, A.M., Tezcan, F.A. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9dbc | | Status: | HPUB -- hold until publication | | Title: | Mn-Bound Structure of Computationally Designed Homotrimer Tet4 | | Authors: | Hoffnagle, A.M., Tezcan, F.A. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbw | | Status: | HPUB -- hold until publication | | Title: | Rh-Bound Structure of Computationally Designed Homotetramer PW1 | | Authors: | Hoffnagle, A.M., Tezcan, F.A. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbd | | Status: | HPUB -- hold until publication | | Title: | Zn-Bound Structure of a Single-Chain Tet4 Variant with an H38E Mutation | | Authors: | Hoffnagle, A.M., Neeley, M.N., Tezcan, F.A. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbf | | Status: | HPUB -- hold until publication | | Title: | Zn-Bound Structure of a Single-Chain Tet4 Variant with an L42W Mutation | | Authors: | Hoffnagle, A.M., Neeley, M.N., Tezcan, F.A. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9db7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NDM-1 complexed with compound 21 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbu | | Status: | HPUB -- hold until publication | | Title: | Apo Structure of Computationally Designed Homotetramer PW1 | | Authors: | Hoffnagle, A.M., Tezcan, F.A. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbv | | Status: | HPUB -- hold until publication | | Title: | Cu-Bound Structure of Computationally Designed Homotetramer PW1 | | Authors: | Hoffnagle, A.M., Tezcan, F.A. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gka | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gjz | | Status: | HOLD -- hold until a certain date | | Title: | Ntaya methyltransferase (MTase) bound to AT-9010 (2''-methyl-2''-fluoro GTP) | | Authors: | Boura, E., Krejcova, K. | | Deposition date: | 2024-08-23 | | Release date: | 2024-10-18 |
|
| PDBID: | 9gk3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkf | | Status: | HPUB -- hold until publication | | Title: | Amyloid Fibril of Heterogeneous nuclear ribonucleoprotein A1A induced by RNA binding | | Authors: | Frey, L., Riek, R.P., Arosio, P., Morelli, C. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gjy | | Status: | HPUB -- hold until publication | | Title: | Bacillus licheniformis nitroreductase | | Authors: | Crennell, S.J., Danson, M.J., Emptage, C. | | Deposition date: | 2024-08-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMTEQSKKQEILDAFQFRHATKEFDPDRKISDEDFQFILEAGRLSPSSVGLEPWQFVVVQNKELREKLRQVSWGAQGQLPTASHFVLLLGRTAKEMRRDSGYVADQLKHVKKMPEDIIENMLKEDGVLESFQDGDFHLYESDRAMFDWVSKQTYIALANMMTAAALIGIDSCPIEGFNYDKVHDILEKEGVLEDGRFDISVMAAFGYRVKEPRPKTRRALDQIVKWVE
|
|
| PDBID: | 9gjx | | Status: | HPUB -- hold until publication | | Title: | Bacillus licheniformis nitroreductase | | Authors: | Crennell, S.J., Danson, M.J., Emptage, C. | | Deposition date: | 2024-08-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMTEQSKKQEILDAFQFRHATKEFDPDRKISDEDFQFILEAGRLSPSSVGLEPWQFVVVQNKELREKLRQVSWGAQGQLPTASHFVLLLGRTAKEMRRDSGYVADQLKHVKKMPEDIIENMLKEDGVLESFQDGDFHLYESDRAMFDWVSKQTYIALANMMTAAALIGIDSCPIEGFNYDKVHDILEKEGVLEDGRFDISVMAAFGYRVKEPRPKTRRALDQIVKWVE
|
|
