| PDBID: | 9g9z | | Status: | HOLD -- hold until a certain date | | Title: | Respiratory supercomplex CI1-CIII2-CIV1 (respirasome) from alphaproteobacterium | | Authors: | Yaikhomba, M., Hirst, J., Croll, T.I., Spikes, T.E. | | Deposition date: | 2024-07-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9g8t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the persulfide dioxygenase (PDO - PA2915) from Pseudomonas aeruginosa | | Authors: | Troilo, F., Giordano, F., Giuffre, A., Giardina, G., Di Matteo, A. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MLKPDITAFFDPATSTYSYVVRDPSSRACAIVDPVLDYDPAAGRTSHASAERLIAHVRQHDLQVEWLLETHVHADHLSAAIFLQRELGGCLAIGARITQVQAKFSGLFNLGEAFPVDGRQFEHLFEDGESFRIGALECRALHTPGHTPACMTYLVGDSAFVGDTLFMPDYGTARCDFPGGDARQLYRSIQRLFALPDATRLFMCHDYTAPGRDEHRCETSVGEQRRHNVHVREGVDEEAFVAMRQQRDATLGMPTLMLPAIQVNMRGGNLPPVEGNGVRYLKIPLDLFLEHHHHHH
|
|
| PDBID: | 9g8v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g99 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Joint neutron and x-ray structure of alginate lyase PsAlg7C soaked with pentamannuronic acid | | Authors: | Wilkens, C., Meilleur, F., Morth, J.P. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g98 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Joint neutron and x-ray structure of alginate lyase PsAlg7C soaked with pentamannuronic acid | | Authors: | Wilkens, C., Meilleur, F., Morth, J.P. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g90 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRED mutant-Y199A/N149L | | Authors: | Xu, H., Zhang, Z., Zhang, Y., Xu, Y., Zhang, L. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRED mutant-Y199A/N149L | | Authors: | Xu, H., Zhang, Z., Zhang, Y., Xu, Y., Zhang, L. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivz | | Status: | HPUB -- hold until publication | | Title: | Apg mutant enzyme D448A of acarbose hydrolase from human gut flora K. grimontii TD1, complex with acarbose | | Authors: | Zhou, J.H., Huang, J.Y. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ang1 receptor-binding domain | | Authors: | Wang, R., Huang, M.D., Jiang, L.G. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ang1-A451D receptor binding domain | | Authors: | Wang, R., Huang, M.D., Jiang, L.G. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9iw1 | | Status: | HPUB -- hold until publication | | Title: | wild type NMN/NaMN adenylyltransferase from Chaetomium thermophilum | | Authors: | Qian, X.-L., Zheng, Y.-C., Chen, C., Xu, J.-H. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9csn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human ribonuclease 7 (RNase 7) in complex with 5''-adenosine monophosphate (5''-AMP) | | Authors: | Tran, T.T.Q., Pham, N.T.H., Calmettes, C., Doucet, N. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9csx | | Status: | HPUB -- hold until publication | | Title: | matrix metalloproteinase-10 proenzyme | | Authors: | Isiorho, E.A. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9csm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human ribonuclease 7 (RNase 7, HsR7) | | Authors: | Tran, T.T.Q., Pham, N.T.H., Calmettes, C., Doucet, N. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9csj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human glyoxalase domain-containing protein 4 (GLOD4) at 2.33 A resolution. | | Authors: | Griswold-Prenner, I., Dou, Y., Jennings, A., Kayser, F. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9cta | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 | | Release date: | 2026-01-23 |
|
| PDBID: | 9ct8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 | | Release date: | 2026-01-23 |
|
| PDBID: | 9ct9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 | | Release date: | 2026-01-23 |
|
| PDBID: | 9ctb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-24 |
|
