| PDBID: | 9jc7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9glc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gl6 | | Status: | HOLD -- hold until a certain date | | Title: | TRPC5 in complex with spin-labelled ligand SpinPico3 | | Authors: | Porav, S.A., Bon, R.S., Hammond, K.L.R. | | Deposition date: | 2024-08-27 | | Release date: | 2025-08-27 |
|
| PDBID: | 9glf | | Status: | HOLD -- hold until a certain date | | Title: | Anthraquinone Pigment Production Regulated by Cinnamic Acid | | Authors: | Su, L., Schmalhofer, M., Grammbitter, G.L.C., Paczia, N., Glatter, T., Groll, M., Bode, H.B. | | Deposition date: | 2024-08-27 | | Release date: | 2025-08-27 | | Sequence: | >Entity 1
GSSHHHHHHSGDPASMNNKNKPNRISPELLATCGYFMPRIFFLNSQYAPQVHWGDVVAALSHFPAGNLDLSSEEFWYEWMINWSKVGDSYINIANSAKSEVSHVRALRSAAACYHWAEFMYFSDRSRKIQLREYIRSCFLSSIKYSDLLVDHQYIVVDKFHMPFFLIFPKGYKEEENHPLPCVILSNGLDSMTEIEILSLAEFFLGKNMAVAIFDGPGQGINLGKSPIAIDMELYVSSIVKLLEDDARINSNLLCFLGISFGGYFALRVAQRIGDKFCCIVNLSGGPEIAEFDKLPRRLKEDFQFAFMQDNSHMQSIFDEIKLDISLPCKTKVFTVHGELDDIFQIDKVKKLDQLWGDNHQLLCYESEAHVCLNKINEYMIQVSDWVSEQFWLNGYKKG
|
|
| PDBID: | 9gl5 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the Thermus thermophilus Q190E mutant of the PilF-GSPIIB domain in the c-di-GMP bound state | | Authors: | Neissner, K., Woehnert, J. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glg | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the Thermus thermophilus Q218E mutant of the PilF-GSPIIB domain in the c-di-GMP bound state | | Authors: | Neissner, K., Woehnert, J. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gld | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbt | | Status: | HPUB -- hold until publication | | Title: | Structure of LAT4 in complex with Phe | | Authors: | Yin, Y.X., Ding, D., Lu, Y.S., Chen, H.Y. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbu | | Status: | HPUB -- hold until publication | | Title: | Structure of LAT4 in complex with digitonin | | Authors: | Yin, Y.X., Ding, D., Lu, Y.S., Chen, H.Y. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jc0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Multidrug resistance-associated protein 2 in complex with SN38G | | Authors: | Yun, C.H., Zhao, P. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The cryo-EM structure of Ac-K58D_G51DA53T a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9dct | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
