| PDBID: | 9oic | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of shaker-IR-I384R | | Authors: | Liu, Y., Contreras, G.F. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oit | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the Escherichia coli Mechanosensitive Channel of Large Conductance (MscL) | | Authors: | Kosgei, A.J., Wensel, T.G. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oia | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oib | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oi4 | | Status: | PROC -- to be processed | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with 1R-0197. | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oi8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oi2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oi7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oj2 | | Status: | PROC -- to be processed | | Title: | sx20S complex (NSF-alphaSNAP-syntaxin-1a), non-hydrolyzing, class 1 | | Authors: | White, K.I., Brunger, A.T. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oi6 | | Status: | PROC -- to be processed | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with FD-0739. | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oi5 | | Status: | PROC -- to be processed | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with PS-4845. | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oid | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oir | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oim | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The von Hippel Lindau-ElonginB-ElonginC (VCB) complex with fragment 9 | | Authors: | Amporndanai, K., Katinas, J.M., Chopra, A., Fesik, S.W. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oie | | Status: | PROC -- to be processed | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with PS-5844. | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oin | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The von Hippel Lindau-ElonginB-ElonginC (VCB) complex with fragment 13 | | Authors: | Amporndanai, K., Katinas, J.M., Chopra, A., Fesik, S.W. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oih | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of full-length Streptococcus mutans GtfD active site mutant (D465A, D584A) with active site glucose | | Authors: | Schormann, N., Deivanayagam, C. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oig | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oif | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oio | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The von Hippel Lindau-ElonginB-ElonginC (VCB) complex with fragments 9 and 14 | | Authors: | Amporndanai, K., Katinas, J.M., Chopra, A., Fesik, S.W. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oii | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oiq | | Status: | PROC -- to be processed | | Title: | The von Hippel Lindau-ElonginB-ElonginC (VCB) complex with fragment 15 | | Authors: | Amporndanai, K., Katinas, J.M., Chopra, A., Fesik, S.W. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oip | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9oiu | | Status: | HPUB -- hold until publication | | Title: | Soltion Structure of His6-Small Ubiquitin-like Modifier (His6-SUMO) | | Authors: | Mallett, T.M., Lamer, T.D., Vederas, J.C. | | Deposition date: | 2025-05-06 | | Sequence: | >Entity 1
MGSSHHHHHHGSGLVPRGSASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
|
|
| PDBID: | 9ois | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of glycosyltransferase family 61 from Sorghum bicolor | | Authors: | Pereira, J.H., Wang, H.T., DeGiovanni, A.M., Scheller, H.V., Adams, P.D. | | Deposition date: | 2025-05-06 |
|
