| PDBID: | 9o4k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o49 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o45 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o46 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o4i | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o4c | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o4u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o4h | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-08 | | Release date: | 2026-04-08 |
|
| PDBID: | 9o4s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o4r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-08 | | Release date: | 2026-04-08 |
|
| PDBID: | 9o4t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | RT XFEL structure of Soybean Lipoxygenase-1 in large unit-cell | | Authors: | Wolff, A.M., Thompson, M.C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o48 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o4o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o4v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | RNase A in complex with Pseudouridine Vanadate and decavanadates | | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtf | | Status: | HPUB -- hold until publication | | Title: | Simkania negevensis CE-clan virulence factor SnCE1 C256A catalytically inactive mutant | | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Simkania negevensis CE-clan virulence factor SnCE1 in complex with hsSUMO1 | | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt8 | | Status: | HPUB -- hold until publication | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2-P155G | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qte | | Status: | HPUB -- hold until publication | | Title: | Simkania negevensis CE-clan virulence factor SnCE1 wildtype | | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtb | | Status: | HPUB -- hold until publication | | Title: | Apo form of the L-protein from Rift Valley Fever Virus (LPapo) | | Authors: | Kral, M., Das, A.R., Kotacka, T., Blahosova, A., Hodek, J., Konvalinka, J., Demo, G., Kozisek, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cytoplasmic 60S maturation intermediate (State D1) | | Authors: | Kargas, V., Warren, A.J. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer | | Authors: | Morozov, V., Wang, L., Kwon, S., Douat, C., Huc, I. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtc | | Status: | HPUB -- hold until publication | | Title: | HINT1 complexed with GS-441524 | | Authors: | Zimberger, C., Ferron, F. | | Deposition date: | 2025-04-08 | | Sequence: | >Entity 1
MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
|
|
| PDBID: | 9qta | | Status: | HOLD -- hold until a certain date | | Title: | Structure of vaccinia virus A26 (residues 1-397) in complex with Fab 10M2146 | | Authors: | Guardado-Calvo, P., Battini, L. | | Deposition date: | 2025-04-08 | | Release date: | 2026-04-08 |
|
