| PDBID: | 8osr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-19 | | Release date: | 2024-10-19 |
|
| PDBID: | 9exj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8x5h | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8oss | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-19 | | Release date: | 2024-10-19 |
|
| PDBID: | 9exl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8x5g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8x5o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the post-fusion core of MjHKUr-CoV spike protein. | | Authors: | Yun, Z., Xia, Y., Fei, S. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8x5p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MjHKUr-CoV spike HR1 in complex with EK1 peptide | | Authors: | Yun, Z., Xia, Y., Fei, S. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8ox3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-30 | | Release date: | 2025-01-30 |
|
| PDBID: | 9exg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Yeast Clathrin Heavy Chain N-terminal domain bound to Epsin-2 peptide (LIDL) | | Authors: | Defelipe, L.A., Bento, I., Garcia Alai, M.M. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8x5t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8oyj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-05-05 | | Release date: | 2024-11-05 |
|
| PDBID: | 8x5u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8x67 | | Status: | HPUB -- hold until publication | | Title: | solution structure of Pru p 7 | | Authors: | Zheng, J., Aizawa, T., Kumeta, H. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP
|
|
| PDBID: | 8jc8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-05-10 | | Release date: | 2024-11-10 |
|
| PDBID: | 9exk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8x60 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8jc9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-05-10 | | Release date: | 2024-11-10 |
|
| PDBID: | 9exf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Yeast Clathrin Heavy Chain N-terminal domain bound to YAP1801 peptide (LIDM) | | Authors: | Defelipe, L.A., Bento, I., Garcia Alai, M.M. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8x68 | | Status: | HPUB -- hold until publication | | Title: | Complex structure of AtHPPD with YH21002 | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8p13 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Rhodopsin-Gi bound with antibody fragments scFv16 and Fab79, conformation 1 | | Authors: | Pamula, F., Tejero, O., Muehle, J., Thoma, R., Schertler, G.F.X., Marino, J., Tsai, C.-J. | | Deposition date: | 2023-05-11 | | Release date: | 2024-11-11 |
|
| PDBID: | 9exu | | Status: | HPUB -- hold until publication | | Title: | Complex of a mutant of the SARS-CoV-2 main protease Mpro with the nsp4/5 substrate peptide (cocrystallization). | | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8x65 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of X11P(P71T) xylanase from a metagenome derived gene from sugarcane bagasse collection site | | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MAQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
| PDBID: | 8p15 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Rhodopsin-Gi bound with antibody fragments scFv16 and Fab79, conformation 2 | | Authors: | Pamula, F., Tejero, O., Muehle, J., Thoma, R., Schertler, G.F.X., Marino, J., Tsai, C.-J. | | Deposition date: | 2023-05-11 | | Release date: | 2024-11-11 |
|
| PDBID: | 9ext | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Yeast Clathrin Heavy Chain N-terminal domain bound to APL2/AP-1 Beta peptide (LLDL) | | Authors: | Defelipe, L.A., Bento, I., Garcia Alai, M.M. | | Deposition date: | 2024-04-08 |
|
