| PDBID: | 9evk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-30 |
|
| PDBID: | 8vvi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9evl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-30 |
|
| PDBID: | 8vvn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9evi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-30 |
|
| PDBID: | 8vmg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-13 |
|
| PDBID: | 9evn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-31 |
|
| PDBID: | 8vnj | | Status: | HPUB -- hold until publication | | Title: | Homing endonuclease I-PpoI-DNA complex:reaction at pH6.0 (K+ MES) with 500 uM Mn2+ for 120s | | Authors: | Chang, C., Gao, Y. | | Deposition date: | 2024-01-13 |
|
| PDBID: | 9evo | | Status: | HPUB -- hold until publication | | Title: | Plasmodium falciparum apical membrane antigen 3D7 | | Authors: | Bentley, G.A., Saul, F.A., Vulliez-Le Normand, B. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 8vnk | | Status: | HPUB -- hold until publication | | Title: | Homing endonuclease I-PpoI-DNA complex:reaction at pH6.0 (K+ MES) with 500 uM Mn2+ for 160s | | Authors: | Chang, C., Gao, Y. | | Deposition date: | 2024-01-13 |
|
| PDBID: | 9evp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8vo5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-14 |
|
| PDBID: | 9evq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8vpu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-17 |
|
| PDBID: | 9evr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8vzg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-11 |
|
| PDBID: | 9evu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8vik | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8vj5 | | Status: | HPUB -- hold until publication | | Title: | Peroxide-Soaked MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-01-05 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 8vt2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vt4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 9evw | | Status: | HPUB -- hold until publication | | Title: | Avian reovirus nonstructural protein sigmaNS | | Authors: | Kascakova, B., Tuma, R. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8vky | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 9evz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8vkx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
