| PDBID: | 8x45 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8ofz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-17 | | Release date: | 2024-09-17 |
|
| PDBID: | 9ex5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8x46 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8ofy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-17 | | Release date: | 2024-09-17 |
|
| PDBID: | 9ex8 | | Status: | HPUB -- hold until publication | | Title: | Free form of a mutant of SARS-CoV-2 main protease Mpro. | | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8x47 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8ofx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-17 | | Release date: | 2024-09-17 |
|
| PDBID: | 9eww | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8x4g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8oi5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-22 | | Release date: | 2024-09-27 |
|
| PDBID: | 9er5 | | Status: | HPUB -- hold until publication | | Title: | Hydrogenase-1 Ni-B state poised at +100mV | | Authors: | Carr, S.B., Li, W., Wong, K.l., Ash, P.A., Vincent, K.A. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
LENKPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRVVDIPRSHHHHHH
>Entity 2
MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERICGVCTGVHALASVYAIEDAIGIKVPDNANIIRNIMLATLWCHDHLVHFYQLAGMDWIDVLDALKADPRKTSELAQSLSSWPKSSPGYFFDVQNRLKKFVEGGQLGIFRNGYWGHPQYKLPPEANLMGFAHYLEALDFQREIVKIHAVFGGKNPHPNWIVGGMPCAINIDESGAVGAVNMERLNLVQSIITRTADFINNVMIPDALAIGQFNKPWSEIGTGLSDKCVLSYGAFPDIANDFGEKSLLMPGGAVINGDFNNVLPVDLVDPQQVQEFVDHAWYRYPNDQVGRHPFDGITDPWYNPGDVKGSDTNIQQLNEQERYSWIKAPRWRGNAMEVGPLARTLIAYHKGDAATVESVDRMMSALNLPLSGIQSTLGRILCRAHEAQWAAGKLQYFFDKLMTNLKNGNLATASTEKWEPATWPTECRGVGFTEAPRGALGHWAAIRDGKIDLYQCVVPTTWNASPRDPKGQIGAYEAALMNTKMAIPEQPLEILRTLHSFDPCLACSTH
|
|
| PDBID: | 8x4w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8oj3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-23 | | Release date: | 2024-09-27 |
|
| PDBID: | 9ex3 | | Status: | HPUB -- hold until publication | | Title: | Ferric-mycobactin receptor (FemA) in complex with dihydroaeruginoic acid | | Authors: | Moynie, L. | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8x4i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8pf6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-15 | | Release date: | 2024-12-15 |
|
| PDBID: | 9ewy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8x4r | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8olb | | Status: | HPUB -- hold until publication | | Title: | SA11 Rotavirus Non-tripsinized Triple Layered Particle | | Authors: | Asensio-Cob, D., Perez-Mata, C., Gomez-Blanco, J., Vargas, J., Rodriguez, J.M., Luque, D. | | Deposition date: | 2023-03-30 | | Release date: | 2024-09-30 |
|
| PDBID: | 9exa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8x4l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8olc | | Status: | HPUB -- hold until publication | | Title: | SA11 Rotavirus Trypsinized Triple Layered Particle | | Authors: | Asensio-Cob, D., Perez-Mata, C., Gomez-Blanco, J., Vargas, J., Rodriguez, J.M., Luque, D. | | Deposition date: | 2023-03-30 | | Release date: | 2024-09-30 |
|
| PDBID: | 9ex6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8x4o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
