| PDBID: | 9eul | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8xbo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 9etx | | Status: | HPUB -- hold until publication | | Title: | KEAP1 BTB in complex with compound 23 | | Authors: | Richardson, W., Bullock, A.N., Rothweiler, E.M., Manning, C.E., Sweeney, M.N., Chalk, R., Huber, K.V.M. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8x8j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 9ety | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8x2b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 9eu0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8x2f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 9eu3 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MPAQPGYTPSADNLKARETFQDDKFGIFIHWGIYSMLADGEWVMHNKNLNWEEYAKLASGFYPAKFNAAEWVAAIKASGAKYITITSRHHDGFSMYATQQSDYNIVDATPFKRDVIHELADECRKQGIRLHLYYSHLDWRRDDYYPLGRTGKGTGRTTQGKWEDYCAFMNNQLTELLTNYGLIGAIWFDGMWDKDIYPDGMTAKTWNLNEQYTLIHRLQPACLIGNNHHITPFAGEDIQIFERDLPGENKAGLSGQDISRLPLETCETMNGMWGYKITDQDYKSTKILIQYLVKAAGKNANLLMNVGPQPNGELPTVAVQRLREMGEWMKIYAPTIQGTRGGVVTPRDWGVTTQKGKTLYVHVLNLDDKALFLPYAGNKLKSAVEYQSRKSVRFIQDRDGILLKFTDKPHSPDYVLELTFANELPLNLEHHHHHH
|
|
| PDBID: | 8x2e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 9eu2 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MPAQPGYTPSADNLKARETFQDDKFGIFIHWGIYSMLADGEWVMHNKNLNWEEYAKLASGFYPAKFNAAEWVAAIKASGAKYITITSRHHDGFSMYATQQSDYNIVDATPFKRDVIHELADECRKQGIRLHLYYSHLDWRRDDYYPLGRTGKGTGRTTQGKWEDYCAFMNNQLTELLTNYGLIGAIWFDGMWDKDIYPDGMTAKTWNLNEQYTLIHRLQPACLIGNNHHITPFAGEDIQIFERDLPGENKAGLSGQDISRLPLETCETMNGMWGYKITDQDYKSTKILIQYLVKAAGKNANLLMNVGPQPNGELPTVAVQRLREMGEWMKIYAPTIQGTRGGVVTPRDWGVTTQKGKTLYVHVLNLDDKALFLPYAGNKLKSAVEYQSRKSVRFIQDRDGILLKFTDKPHSPDYVLELTFANELPLNLEHHHHHH
|
|
| PDBID: | 8x2g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 9eu4 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MQQKYQPTEANLKARSEFQDNKFGIFLHWGLYAMLATGEWTMTNNNLNYKEYAKLAGGFYPSKFDADKWVAAIKASGAKYICFTTRHHEGFSMFDTKYSDYNIVKATPFKRDVVKELADACAKHGIKLHFYYSHIDWYREDAPQGRTGRRTGRPNPKGDWKSYYQFMNNQLTELLTNYGPIGAIWFDGWWDQDINPDFDWELPEQYALIHRLQPACLVGNNHHQTPFAGEDIQIFERDLPGENTAGLSGQSVSHLPLETCETMNGMWGYKITDQNYKSTKTLIHYLVKAAGKDANLLMNIGPQPDGELPEVAVQRLKEVGEWMSKYGETIYGTRGGLVAPHDWGVTTQKGNKLYVHILNLQDKALFLPIVDKKVKKAVVFADKTPVRFTKNKEGIVLELAKVPTDVDYVVELTIDDEHHHHHH
|
|
| PDBID: | 8x26 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 9eup | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8x27 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 9ep5 | | Status: | HPUB -- hold until publication | | Title: | Alpha-Galactosaminidase from Environmental sample (99.2% identity to Myxococcus fulvus enzyme) | | Authors: | Roth, C., Moroz, O.V., Miranda, S.A.D., Jahn, L., Blagova, E., Lebedev, A.A., Segura, D.R., Stringer, M.A., Friis, E.P., Davies, G.J., Wilson, K.S. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8x28 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 9ep6 | | Status: | HPUB -- hold until publication | | Title: | Alpha-Galactosaminidase family GH114 from Fusarium solani | | Authors: | Roth, C., Moroz, O.V., Miranda, S.A.D., Jahn, L., Blagova, E., Lebedev, A.A., Segura, D.R., Stringer, M.A., Friis, E.P., Davies, G.J., Wilson, K.S. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8x29 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 9ev2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8x2d | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 9euv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9ev3 | | Status: | HPUB -- hold until publication | | Title: | Corynebacterium glutamicum pyruvate:quinone oxidoreductase (PQO) purified from bacteria grown in acetate minimal medium | | Authors: | Da Silva Lameira, C., Muenssinger, S., Yang, L., Eikmanns, B.J., Bellinzoni, M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8x2n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
