| PDBID: | 9eov | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8w0n | | Status: | HPUB -- hold until publication | | Title: | IRED crystal structure | | Authors: | Peat, T.S., Newman, J. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8w0o | | Status: | HPUB -- hold until publication | | Title: | GDH-105 crystal structure | | Authors: | Peat, T.S., Newman, J. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 9ep0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8w11 | | Status: | HPUB -- hold until publication | | Title: | Structure of human PIN1 covalently derivatized with SuFEx compound | | Authors: | Louie, G.V., Noel, J.P., Wang, W.-M., Kelly, J.W. | | Deposition date: | 2024-02-14 |
|
| PDBID: | 9ep2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex of human carbonic anhydrase I with 4-sulfamoylphenyl 3-(p-tolylthio)propanoate | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2024-03-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 9ep7 | | Status: | HPUB -- hold until publication | | Title: | Poecitoxin-1a from Poecilotheria subfusca spider, a new potent peptide blocker of the human Cav1.2 channel subtype | | Authors: | Kurz, M., Kurz, M. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8vx4 | | Status: | HPUB -- hold until publication | | Title: | Human OGG1 bound to a 35-bp DNA with an 8-oxoG in the middle | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8w1g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 9epd | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 8 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w13 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 9ep9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w14 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 9epg | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-16 |
|
| PDBID: | 9eph | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w1j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-16 |
|
| PDBID: | 9epi | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-16 |
|
| PDBID: | 8w1p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-16 |
|
| PDBID: | 8w1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-17 |
|
| PDBID: | 9ep8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 in complex with a 8-(azaindolyl)-benzoazepinone inhibitor | | Authors: | Pala, D., Clark, D., Pioselli, B., Accetta, A., Rancati, F. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 9epj | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 41 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w1u | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Main protease bound to non-covalent lead molecule NZ-804 | | Authors: | Bian, X., Tang, S., Sacchettini, J.C. | | Deposition date: | 2024-02-18 |
|
| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
