PDBID: | 8xev | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii | Authors: | Chen, Y.H., Chen, C.J. | Deposition date: | 2023-12-13 | Release date: | 2024-12-13 |
|
PDBID: | 8xex | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii with AMP | Authors: | Chen, Y.H., Chen, C.J. | Deposition date: | 2023-12-13 | Release date: | 2024-12-13 |
|
PDBID: | 8xf5 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii with ADP | Authors: | Chen, Y.H., Chen, C.J. | Deposition date: | 2023-12-13 | Release date: | 2024-12-13 |
|
PDBID: | 8jx4 | Status: | HOLD -- hold until a certain date | Title: | Structure of the catalytic domain of pseudomurein endo-isopeptidases PeiW | Authors: | Guo, L.Z., Zhao, N.L., Len, H., Wang, S.X., Cha, G.H., Bai, L.p., Bao, R. | Deposition date: | 2023-06-30 | Release date: | 2024-09-30 |
|
PDBID: | 9ezf | Status: | HOLD -- hold until a certain date | Title: | membrane complex from Haemophilus influenzae - conformation C | Authors: | Castro, D.S.K.V., Delepelaire, P., Biou, V. | Deposition date: | 2024-04-12 | Release date: | 2025-04-12 |
|
PDBID: | 9f49 | Status: | HOLD -- hold until a certain date | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | Authors: | Pichel, A., van Raaij, M.J. | Deposition date: | 2024-04-26 | Release date: | 2024-06-21 | Sequence: | >Entity 1 KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
PDBID: | 8jzp | Status: | HOLD -- hold until a certain date | Title: | Structure of mouse C5a-human C5aR1-Go complex | Authors: | Yadav, M.K., Yadav, R., Maharana, J., Sarma, P., Banerjee, R., Shukla, A.K., Gati, C. | Deposition date: | 2023-07-06 | Release date: | 2025-01-06 |
|
PDBID: | 8k0i | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-09 | Release date: | 2025-01-09 |
|
PDBID: | 8k0u | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-10 | Release date: | 2025-01-10 |
|
PDBID: | 8k0t | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-10 | Release date: | 2025-01-10 |
|
PDBID: | 8k18 | Status: | HOLD -- hold until a certain date | Title: | Neutralization antibody ZCP4C9 bound with SARS-CoV-2 Omicron BA.5 RBD | Authors: | Bingjie, T., Shangyu, D. | Deposition date: | 2023-07-10 | Release date: | 2025-01-22 |
|
PDBID: | 8k19 | Status: | HOLD -- hold until a certain date | Title: | Neutralization antibody ZCP3B4 bound with SARS-CoV-2 Omicron BA.5 RBD | Authors: | Tang, B., Dang, S. | Deposition date: | 2023-07-10 | Release date: | 2025-01-22 |
|
PDBID: | 8k17 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-10 | Release date: | 2025-01-10 |
|
PDBID: | 8k1x | Status: | HOLD -- hold until a certain date | Title: | Biochemical and structural characterization of a multifunctional cytochrome P450 SpcN in staurosporine biosynthesis | Authors: | Xiao, F., Dong, S., Feng, Y., Li, W. | Deposition date: | 2023-07-11 | Release date: | 2024-10-11 |
|
PDBID: | 8pr8 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-12 | Release date: | 2025-01-12 |
|
PDBID: | 8xhw | Status: | HOLD -- hold until a certain date | Title: | Haloquadratum walsbyi middle rhodopsin mutant - D84N | Authors: | Ko, L.N., Lim, G.Z., Yang, C.S. | Deposition date: | 2023-12-18 | Release date: | 2024-12-18 |
|
PDBID: | 8xhn | Status: | HOLD -- hold until a certain date | Title: | Streptococcus pneumoniae-BceAB-ADP-Peptidisc Sample. | Authors: | He, Y., Li, J., Luo, M. | Deposition date: | 2023-12-18 | Release date: | 2024-12-18 |
|
PDBID: | 8xhm | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-12-18 | Release date: | 2024-12-18 |
|
PDBID: | 8xic | Status: | HOLD -- hold until a certain date | Title: | Structure of Trioxacarcin A covalently bound to guanosine-2''-fluorinated d(AACCGGTT)2 | Authors: | Gao, R.Q., Cao, C., Tang, G.L. | Deposition date: | 2023-12-19 | Release date: | 2024-12-19 |
|
PDBID: | 8k2u | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-13 | Release date: | 2025-01-13 |
|
PDBID: | 8xi3 | Status: | HOLD -- hold until a certain date | Title: | Structure of mouse SCMC-14-3-3gama complex | Authors: | Chi, P., Han, Z., Jiao, H., Li, J., Wang, X., Hu, H., Deng, D. | Deposition date: | 2023-12-19 | Release date: | 2024-12-19 |
|
PDBID: | 8k4g | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-18 | Release date: | 2025-01-18 |
|
PDBID: | 8k4k | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-19 | Release date: | 2025-01-22 |
|
PDBID: | 9f1p | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-04-19 | Release date: | 2025-04-19 |
|
PDBID: | 8k51 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-20 | Release date: | 2024-07-20 |
|