| PDBID: | 8iki | | Status: | HOLD -- hold until a certain date | | Title: | Mycobacterium smegmatis ileS T-box RNA in complex with acc.11-tRNA | | Authors: | Jia, X., Luo, B., Su, Z. | | Deposition date: | 2023-02-28 | | Release date: | 2024-08-28 |
|
| PDBID: | 8iko | | Status: | HOLD -- hold until a certain date | | Title: | S3.11-T-box in complex with acc.11-tRNA | | Authors: | Jia, X., Zhang, C., Luo, B., Frandsen, J.K., Watkins, A.M., Li, K., Zhang, M., Wei, X., Yang, Y., Henkin, T.M., Su, Z. | | Deposition date: | 2023-02-28 | | Release date: | 2024-08-28 |
|
| PDBID: | 8ikt | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-03-01 | | Release date: | 2024-09-01 |
|
| PDBID: | 8ikv | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-03-01 | | Release date: | 2024-09-01 |
|
| PDBID: | 8iky | | Status: | HOLD -- hold until a certain date | | Title: | The Leeuwenhoekiella ORF-less Group IIC intron DEAR6 at apo state | | Authors: | Zhu, H.Z., Liu, J.J.G. | | Deposition date: | 2023-03-01 | | Release date: | 2024-09-01 |
|
| PDBID: | 8vxb | | Status: | HOLD -- hold until a certain date | | Title: | Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin | | Authors: | Nalam, P., Cook, P., Smith, B. | | Deposition date: | 2024-02-04 | | Release date: | 2025-02-04 | | Sequence: | >Entity 1
MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
|
|
| PDBID: | 8ilo | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Monkeypox I7 protease in the apo-form | | Authors: | Lan, W., You, T., Li, D., Dong, X., Wang, H., Xu, J., Wang, W., Gao, Y., Yang, H. | | Deposition date: | 2023-03-04 | | Release date: | 2024-09-04 |
|
| PDBID: | 8ilp | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Monkeypox I7 protease in the complex with E64D | | Authors: | Lan, W., You, T., Li, D., Dong, X., Wang, H., Xu, J., Wang, W., Gao, Y., Yang, H. | | Deposition date: | 2023-03-04 | | Release date: | 2024-09-04 |
|
| PDBID: | 8vxo | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of modified JEV virus E protein dimer | | Authors: | Galkin, A., Pozharski, E., Li, Y. | | Deposition date: | 2024-02-05 | | Release date: | 2025-02-05 |
|
| PDBID: | 9eoy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-15 | | Release date: | 2025-03-15 |
|
| PDBID: | 9exs | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-08 | | Release date: | 2025-04-08 |
|
| PDBID: | 8ipp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-03-14 | | Release date: | 2024-09-18 |
|
| PDBID: | 8ipf | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of a DARPin protein | | Authors: | Ngo, K.H., Liew, C.W., Heddi, B., Phan, A.T. | | Deposition date: | 2023-03-14 | | Release date: | 2024-09-18 |
|
| PDBID: | 8is1 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of a polyketide aromatase/cyclase Abx(+)C from Actinomycetes sp. MA7150 | | Authors: | Luo, S., Chen, X., Jiang, K., Qu, X. | | Deposition date: | 2023-03-20 | | Release date: | 2024-09-20 |
|
| PDBID: | 9en7 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-12 | | Release date: | 2025-03-12 |
|
| PDBID: | 8iuq | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of a polyketide cyclase ForU from Streptomyces kanamyceticus | | Authors: | Luo, S., Zhu, C., Jiang, K., Qu, X. | | Deposition date: | 2023-03-24 | | Release date: | 2024-09-24 |
|
| PDBID: | 8iur | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of a polyketide decarboxylase Abx(+)O from Actinomycetes sp. MA7150 | | Authors: | Luo, S., Zhu, C., Jiang, K., Qu, X. | | Deposition date: | 2023-03-24 | | Release date: | 2024-09-24 |
|
| PDBID: | 8ww6 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 9ent | | Status: | HOLD -- hold until a certain date | | Title: | SSX structure of Autotaxin in cryogenic conditions | | Authors: | Eymery, M.C., McCarthy, A.A., Foos, N., Basu, S. | | Deposition date: | 2024-03-13 | | Release date: | 2025-03-13 |
|
| PDBID: | 8iyy | | Status: | HOLD -- hold until a certain date | | Title: | Single excitation and two emissions pH sensor protein(SITE-pHorin)_pH7.0 | | Authors: | Li, S.A., Kang, J.S. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8iz0 | | Status: | HOLD -- hold until a certain date | | Title: | mTurquoise2 W66Y | | Authors: | Li, S.A., Kang, J.S. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8iz1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8iz2 | | Status: | HOLD -- hold until a certain date | | Title: | Single excitation and two emissions pH sensor protein (SITE-pHorin)_C203E_pH8.0 | | Authors: | Kang, J.S., Li, S.A. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8iyv | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of trypsin-famotidine complex at 2.10 Angstroms resolution | | Authors: | Ahmad, M.S., Kalam, N., Akbar, Z., Rasheed, S., Choudhary, M.I. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8izi | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-07 | | Release date: | 2024-10-07 |
|
