| PDBID: | 8p8b | | Status: | HPUB -- hold until publication | | Title: | Mycoplasma pneumoniae large ribosomal subunit in chloramphenicol-treated cells | | Authors: | Schacherl, M., Xue, L., Spahn, C.M.T., Mahamid, J. | | Deposition date: | 2023-05-31 | | Release date: | 2024-11-30 |
|
| PDBID: | 9f07 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8wih | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463A in complex with ATP | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8p7x | | Status: | HPUB -- hold until publication | | Title: | Mycoplasma pneumoniae 70S ribosome in chloramphenicol-treated cells | | Authors: | Schacherl, M., Xue, L., Spahn, C.M.T., Mahamid, J. | | Deposition date: | 2023-05-31 | | Release date: | 2024-11-30 |
|
| PDBID: | 8wii | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463A in complex with Obafluorin | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8p7y | | Status: | HPUB -- hold until publication | | Title: | Mycoplasma pneumoniae 70S ribosome with second S4 protein on large subunit | | Authors: | Schacherl, M., Xue, L., Spahn, C.M.T., Mahamid, J. | | Deposition date: | 2023-05-31 | | Release date: | 2024-11-30 |
|
| PDBID: | 9f0a | | Status: | HPUB -- hold until publication | | Title: | N5 Adduct of LSD1-CoREST in complex with MC4455 | | Authors: | Barone, M., Mattevi, A. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8wij | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant L489M in complex with Obafluorin | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 9eyn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8wj4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS bound to AMP | | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 9ezi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9ezm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8wis | | Status: | HPUB -- hold until publication | | Title: | Structure of hemagglutinin from Asiatic toad influenza-like virus complexed with human receptor analog LSTc | | Authors: | Zhang, D., Xie, Y.F. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 9eum | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8wir | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of E447A Acyl-CoA Dehydrogenase FadE15 mutant from Mycobacteria tuberculosis in complex with C4CoA | | Authors: | Liu, X., Chen, R., Ma, M. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 9byi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8wiw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 9bw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8wja | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with LmBrPhe and an ATP analogue | | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 9bw6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8wix | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wiy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 9bw5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8wiz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 9bw2 | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Reduced Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-20 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
