| PDBID: | 8p6h | | Status: | HPUB -- hold until publication | | Title: | Bovine naive ultralong antibody AbBLV5B8* collected at 100K | | Authors: | Clarke, J.D., Douangamath, A., Mikolajek, H., Stuart, D.I., Owens, R.J. | | Deposition date: | 2023-05-26 | | Release date: | 2024-11-26 |
|
| PDBID: | 9ezs | | Status: | HPUB -- hold until publication | | Title: | XFEL structure of free hNQO1 unmixed (P4502) | | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8whk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 9ezt | | Status: | HPUB -- hold until publication | | Title: | XFEL structure of hNQO1 mixed with NADH for 1190ms (P4502) | | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8whl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 9ezu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8whm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ELKS2/LL5beta complex | | Authors: | Jia, X., Wei, Z. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8who | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH20541 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 9ezv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9ezw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8whp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH201042 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8p6p | | Status: | HPUB -- hold until publication | | Title: | Mycoplasma pneumoniae small ribosomal subunit in chloramphenicol-treated cells | | Authors: | Schacherl, M., Xue, L., Spahn, C.M.T., Mahamid, J. | | Deposition date: | 2023-05-27 | | Release date: | 2024-11-27 |
|
| PDBID: | 9f04 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8whq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH21398 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 | | Sequence: | >Entity 1
GSHMVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKSEFLPGFERVEDASSFPLDYGIRRLDHAVGNVPELGPALTYVAGFTGFHQFAEFTADDVGTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFRTLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLLQIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTLEAKQLVG
|
|
| PDBID: | 8wi0 | | Status: | HPUB -- hold until publication | | Title: | wt-hMRP5 inward-open | | Authors: | Liu, Z.M., Huang, Y. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8p6s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-05-29 | | Release date: | 2024-11-29 |
|
| PDBID: | 9f05 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8wi2 | | Status: | HPUB -- hold until publication | | Title: | RD-hMRP5-inward open | | Authors: | Liu, Z.M., Huang, Y. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 9f06 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8wi4 | | Status: | HPUB -- hold until publication | | Title: | m6-hMRP5 inward open | | Authors: | Liu, Z.M., Huang, Y. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 9f08 | | Status: | HPUB -- hold until publication | | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Covalent complex with 2-deoxyribose. | | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8wie | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wia | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463S | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 9f02 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 envelope glycoprotein (BG505 gp140 SOSIP.664) trimer in complex with three copies of ELC07 broadly neutralizing antibody. | | Authors: | Hope, J., Alguel, Y., Nans, A., Cherepanov, P. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8wig | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463S/Q484A | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
