| PDBID: | 9f07 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f09 | | Status: | HPUB -- hold until publication | | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Complex with 2-deoxyribose, 7-Bromo-1H-imidazo[4,5-b]pyridine and 2''-deoxycytidine | | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3m | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR4-Gq complex in pH6.5 | | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the hGPR4-Gq complex in pH6.5 | | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3q | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR4-Gs complex in pH7.6 | | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the receptor of hGPR68-Gs complex in pH6.0 | | Authors: | Zhong, Y.N., Guo, L.L. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3c | | Status: | HPUB -- hold until publication | | Title: | Dienelactone hydrolase family protein | | Authors: | Hwang, J., Lee, J.H., Do, H. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3i | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Protein Glutaminase FBPG(Flavobacterium sp.316) | | Authors: | Long, Y.T., Lan, D.M., Wang, Y.H. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z3f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bee | | Status: | HPUB -- hold until publication | | Title: | alphaB-crystallin N-terminal IXI variant in a fibril state | | Authors: | McFarland, R., Reichow, S.L. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bem | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with seven Tungstates bound | | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9beb | | Status: | HPUB -- hold until publication | | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight Tungstates bound | | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bea | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SARS CoV-2 full-length spike protein with internal tag, 2RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9be7 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9be8 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9be9 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 Env 16055 dGly4 NFL | | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | | Deposition date: | 2024-04-15 |
|
