PDBID: | 9bam | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-04 |
|
PDBID: | 8vtp | Status: | HPUB -- hold until publication | Title: | Structure of FabS1CE-EPR-1, a high affinity antibody for the erythropoeitin receptor | Authors: | Singer, A.U., Bruce, H.A., Blazer, L., Adams, J.J., Sidhu, S.S. | Deposition date: | 2024-01-26 |
|
PDBID: | 8vtr | Status: | HPUB -- hold until publication | Title: | Structure of FabS1CE3-EPR-1, an elbow-locked high affinity antibody for the erythropoeitin receptor (orthorhombic form) | Authors: | Singer, A.U., Bruce, H.A., Pavlenco, A., Ploder, L., Luu, G., Blazer, L., Adams, J.J., Sidhu, S.S. | Deposition date: | 2024-01-26 |
|
PDBID: | 9bci | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 8gdq | Status: | HPUB -- hold until publication | Title: | BMP-9 Monomer Growth Factor with Cysteinylation | Authors: | Schwartze, T.A., Hinck, A.P. | Deposition date: | 2023-03-06 | Release date: | 2024-09-11 |
|
PDBID: | 9bct | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 8vte | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-26 |
|
PDBID: | 9be5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-14 |
|
PDBID: | 8vtg | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-26 |
|
PDBID: | 8ghl | Status: | HPUB -- hold until publication | Deposition date: | 2023-03-10 | Release date: | 2024-09-11 |
|
PDBID: | 9be6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-14 |
|
PDBID: | 8vth | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-26 |
|
PDBID: | 9b0c | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-11 |
|
PDBID: | 8vt8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-26 |
|
PDBID: | 9bg3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-18 |
|
PDBID: | 8vtf | Status: | HPUB -- hold until publication | Title: | A structural study of selectivity mechanisms for JNK3 and p38 alpha with indazole scaffold probing compounds | Authors: | Park, H., Feng, Y. | Deposition date: | 2024-01-26 |
|
PDBID: | 8vti | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-26 |
|
PDBID: | 9b0t | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of E227Q variant of uMtCK1 in complex with transition state analog | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | Deposition date: | 2024-03-12 |
|
PDBID: | 8vtq | Status: | HPUB -- hold until publication | Title: | Crystal Structure of human Tryptophan 2,3-dioxygenase in complex with PPN3 inhibitor | Authors: | Geeraerts, Z., Yeh, S.-R. | Deposition date: | 2024-01-26 |
|
PDBID: | 9b0u | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of E227Q variant of uMtCK1 incubated with ADP and phosphocreatine at pH 8.0 | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | Deposition date: | 2024-03-12 |
|
PDBID: | 8vu0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-27 |
|
PDBID: | 9b0e | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-12 |
|
PDBID: | 8vtz | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-27 |
|
PDBID: | 9b0n | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-12 |
|
PDBID: | 8vu1 | Status: | HPUB -- hold until publication | Title: | Structure of FabS1CE3-EPR-1, an elbow-locked high affinity antibody for the erythropoeitin receptor (trigonal form) | Authors: | Singer, A.U., Bruce, H.A., Pavlenco, A., Ploder, L., Luu, G., Blazer, L., Adams, J.J., Sidhu, S.S. | Deposition date: | 2024-01-27 | Sequence: | >Entity 1 EVQLVESGGGLVQPGGSLRLSCAASGFNLRSYYMHWVRQAPGKGLEWVASISPYYSYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARHGYGAMDYWGQGTLVTVFNQIKGPSVFPLAPSSKSTSGGTAALGCLVKDYWPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT
>Entity 2 DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSYSLITFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVSWYVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTQGTTSVTKSFNRGEC
|
|