| PDBID: | 8hx1 | | Status: | HOLD -- hold until a certain date | | Title: | Focused cryo-EM map of MsDps2 from MsDps2-DNA complex of Mycobacterium smegmatis | | Authors: | Dutta, S., Garg, P. | | Deposition date: | 2023-01-03 | | Release date: | 2024-07-03 |
|
| PDBID: | 8fpq | | Status: | HOLD -- hold until a certain date | | Title: | PCSK9 in complex with an inhibitor | | Authors: | Xu, M., Chopra, R. | | Deposition date: | 2023-01-05 | | Release date: | 2024-07-10 |
|
| PDBID: | 8hyr | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human KARS apo | | Authors: | Zhang, X., Wang, Y. | | Deposition date: | 2023-01-07 | | Release date: | 2024-07-07 | | Sequence: | >Entity 1
MSVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKELEHHHHHH
|
|
| PDBID: | 8i0p | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i0r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i0s | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i0u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i0v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i0w | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i3v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-18 | | Release date: | 2024-04-18 |
|
| PDBID: | 8fvq | | Status: | HOLD -- hold until a certain date | | Title: | PCSK9 in complex with an inhibitor | | Authors: | Xu, M., Chopra, R. | | Deposition date: | 2023-01-19 | | Release date: | 2024-07-10 |
|
| PDBID: | 8fvm | | Status: | HOLD -- hold until a certain date | | Title: | PCSK9 in complex with an inhibitor | | Authors: | Xu, M., Chopra, R. | | Deposition date: | 2023-01-19 | | Release date: | 2024-07-10 |
|
| PDBID: | 8fvn | | Status: | HOLD -- hold until a certain date | | Title: | PCSK9 in complex with an inhibitor | | Authors: | Xu, M., Chopra, R. | | Deposition date: | 2023-01-19 | | Release date: | 2024-07-10 |
|
| PDBID: | 8fvo | | Status: | HOLD -- hold until a certain date | | Title: | PCSK9 in complex with an inhibitor | | Authors: | Xu, M., Chopra, R. | | Deposition date: | 2023-01-19 | | Release date: | 2024-07-10 |
|
| PDBID: | 8fvp | | Status: | HOLD -- hold until a certain date | | Title: | PCSK9 in complex with an inhibitor | | Authors: | Xu, M., Chopra, R. | | Deposition date: | 2023-01-19 | | Release date: | 2024-07-10 |
|
| PDBID: | 8i7s | | Status: | HOLD -- hold until a certain date | | Title: | The crystal structure of human abl1 kinase domain in complex with ABL1-B1 | | Authors: | Zhu, C., Zhang, Z. | | Deposition date: | 2023-02-02 | | Release date: | 2024-08-02 |
|
| PDBID: | 8i7t | | Status: | HOLD -- hold until a certain date | | Title: | The crystal structure of human abl1 kinase domain in complex with ABL1-B4 | | Authors: | Zhu, C., Zhang, Z. | | Deposition date: | 2023-02-02 | | Release date: | 2024-08-02 |
|
| PDBID: | 8i96 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of TLR7/TH-407b complex | | Authors: | Zhang, Z. | | Deposition date: | 2023-02-06 | | Release date: | 2024-08-06 |
|
| PDBID: | 8ib4 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-02-09 | | Release date: | 2024-08-20 |
|
| PDBID: | 8ib5 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-02-09 | | Release date: | 2024-08-20 |
|
| PDBID: | 8ib6 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-02-09 | | Release date: | 2024-08-20 |
|
| PDBID: | 8ib7 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-02-09 | | Release date: | 2024-08-20 |
|
| PDBID: | 8ib9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-02-10 | | Release date: | 2024-08-20 |
|
| PDBID: | 8ibc | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-02-10 | | Release date: | 2024-08-20 |
|
