| PDBID: | 8qj2 | | Status: | HPUB -- hold until publication | | Title: | Structure of active state MC4R in complex with a potent ligand mimicking nanobody | | Authors: | Busch, A., Jaakola, V.-P., Masiulis, S. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of human IDO1 bound to Compound 23 | | Authors: | Steinbacher, S., Lammens, A., Harris, S.F. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u59 | | Status: | HPUB -- hold until publication | | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-12 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8wci | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 | | Release date: | 2025-03-12 |
|
| PDBID: | 8qjb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qja | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qju | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 | | Release date: | 2025-03-13 |
|
| PDBID: | 8qjh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qje | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 | | Release date: | 2024-12-13 |
|
| PDBID: | 8u5w | | Status: | HPUB -- hold until publication | | Title: | De novo designed pentameric helical bundle protein | | Authors: | Bick, M.J., Xu, C., Sankaran, B., Baker, D. | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qk7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8qk0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 | | Release date: | 2024-12-14 |
|
| PDBID: | 8qk6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8qk4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u6z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 |
|
