PDBID: | 8pf6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-15 | Release date: | 2024-12-15 |
|
PDBID: | 8pf7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-15 | Release date: | 2024-12-15 |
|
PDBID: | 8jqx | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-15 | Release date: | 2024-09-30 |
|
PDBID: | 8t68 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Crystal Structure of the SET Domain of Human Histone-Lysine N-Methyltransferase SUV420H1 in complex with RQ3-111 | Authors: | Zeng, H., Dong, A., Brown, P.J., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | Deposition date: | 2023-06-15 |
|
PDBID: | 8pfs | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8jri | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8jrh | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8jrf | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8jr7 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-25 |
|
PDBID: | 8jra | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-25 |
|
PDBID: | 8jrg | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8jr6 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-25 |
|
PDBID: | 8jr8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8t6m | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-21 |
|
PDBID: | 8pg1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-17 | Release date: | 2024-12-17 |
|
PDBID: | 8jrt | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-17 | Release date: | 2024-12-17 |
|
PDBID: | 8js2 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-18 | Release date: | 2024-12-18 |
|
PDBID: | 8jry | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2023-06-18 |
|
PDBID: | 8phh | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of Atkinsonella Hypoxylon Virus-like particles. | Authors: | Byrne, M.J., Sainsbury, F. | Deposition date: | 2023-06-19 |
|
PDBID: | 8jse | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-19 | Release date: | 2024-12-19 |
|
PDBID: | 8jsa | Status: | AUCO -- author corrections pending review | Deposition date: | 2023-06-19 |
|
PDBID: | 8phc | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-19 | Release date: | 2024-12-19 |
|
PDBID: | 8phm | Status: | HPUB -- hold until publication | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | Deposition date: | 2023-06-20 | Release date: | 2024-12-20 | Sequence: | >Entity 1 NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8jsq | Status: | AUCO -- author corrections pending review | Deposition date: | 2023-06-20 |
|
PDBID: | 8phz | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 | Release date: | 2024-09-20 |
|