[English] 日本語
Yorodumi
- PDB-8av2: Crystal structure for the FnIII module of mouse LEP-R in complex ... -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 8av2
TitleCrystal structure for the FnIII module of mouse LEP-R in complex with the anti-LEP-R nanobody VHH-4.80
Components
  • Leptin receptor
  • anti-mLEPR VHH 4-80
KeywordsCYTOKINE / leptin / LEP-R / obesity / metabolism / energy balance
Function / homology
Function and homology information


negative regulation of locomotor rhythm / leptin receptor activity / sexual reproduction / regulation of bone remodeling / negative regulation of eating behavior / leptin-mediated signaling pathway / regulation of transport / bone growth / protein-hormone receptor activity / regulation of feeding behavior ...negative regulation of locomotor rhythm / leptin receptor activity / sexual reproduction / regulation of bone remodeling / negative regulation of eating behavior / leptin-mediated signaling pathway / regulation of transport / bone growth / protein-hormone receptor activity / regulation of feeding behavior / glial cell proliferation / response to leptin / cell surface receptor signaling pathway via STAT / cytokine receptor activity / glycogen metabolic process / negative regulation of hydrolase activity / eating behavior / energy homeostasis / cytokine binding / peptide hormone binding / T cell differentiation / negative regulation of gluconeogenesis / cholesterol metabolic process / phagocytosis / negative regulation of autophagy / positive regulation of insulin secretion involved in cellular response to glucose stimulus / cytokine-mediated signaling pathway / glucose homeostasis / transmembrane signaling receptor activity / positive regulation of cold-induced thermogenesis / angiogenesis / basolateral plasma membrane / positive regulation of MAPK cascade / signaling receptor complex / external side of plasma membrane / positive regulation of cell population proliferation / signal transduction / : / identical protein binding / plasma membrane
Similarity search - Function
Leptin receptor, immunoglobulin-like domain / Obesity receptor immunoglobulin like domain / Short hematopoietin receptor, family 1, conserved site / Immunoglobulin C2-set-like, ligand-binding / Ig-like C2-type domain / Long hematopoietin receptor, Gp130 family 2, conserved site / Long hematopoietin receptor, gp130 family signature. / Fibronectin type III domain / Fibronectin type 3 domain / Fibronectin type-III domain profile. ...Leptin receptor, immunoglobulin-like domain / Obesity receptor immunoglobulin like domain / Short hematopoietin receptor, family 1, conserved site / Immunoglobulin C2-set-like, ligand-binding / Ig-like C2-type domain / Long hematopoietin receptor, Gp130 family 2, conserved site / Long hematopoietin receptor, gp130 family signature. / Fibronectin type III domain / Fibronectin type 3 domain / Fibronectin type-III domain profile. / Fibronectin type III / Fibronectin type III superfamily / Ig-like domain profile. / Immunoglobulin-like domain / Immunoglobulin-like fold / Immunoglobulins / Immunoglobulin-like / Sandwich / Mainly Beta
Similarity search - Domain/homology
Biological speciesMus musculus (house mouse)
Lama glama (llama)
MethodX-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 1.75 Å
AuthorsVerstraete, K. / Savvides, S.N. / Verschueren, K.G. / Tsirigotaki, A.
Funding support Belgium, 1items
OrganizationGrant numberCountry
Research Foundation - Flanders (FWO)G0G0619N Belgium
CitationJournal: Nat Struct Mol Biol / Year: 2023
Title: Mechanism of receptor assembly via the pleiotropic adipokine Leptin.
Authors: Alexandra Tsirigotaki / Ann Dansercoer / Koen H G Verschueren / Iva Marković / Christoph Pollmann / Maximillian Hafer / Jan Felix / Catherine Birck / Wouter Van Putte / Dominiek Catteeuw / ...Authors: Alexandra Tsirigotaki / Ann Dansercoer / Koen H G Verschueren / Iva Marković / Christoph Pollmann / Maximillian Hafer / Jan Felix / Catherine Birck / Wouter Van Putte / Dominiek Catteeuw / Jan Tavernier / J Fernando Bazan / Jacob Piehler / Savvas N Savvides / Kenneth Verstraete /
Abstract: The adipokine Leptin activates its receptor LEP-R in the hypothalamus to regulate body weight and exerts additional pleiotropic functions in immunity, fertility and cancer. However, the structure and ...The adipokine Leptin activates its receptor LEP-R in the hypothalamus to regulate body weight and exerts additional pleiotropic functions in immunity, fertility and cancer. However, the structure and mechanism of Leptin-mediated LEP-R assemblies has remained unclear. Intriguingly, the signaling-competent isoform of LEP-R is only lowly abundant amid several inactive short LEP-R isoforms contributing to a mechanistic conundrum. Here we show by X-ray crystallography and cryo-EM that, in contrast to long-standing paradigms, Leptin induces type I cytokine receptor assemblies featuring 3:3 stoichiometry and demonstrate such Leptin-induced trimerization of LEP-R on living cells via single-molecule microscopy. In mediating these assemblies, Leptin undergoes drastic restructuring that activates its site III for binding to the Ig domain of an adjacent LEP-R. These interactions are abolished by mutations linked to obesity. Collectively, our study provides the structural and mechanistic framework for how evolutionarily conserved Leptin:LEP-R assemblies with 3:3 stoichiometry can engage distinct LEP-R isoforms to achieve signaling.
History
DepositionAug 26, 2022Deposition site: PDBE / Processing site: PDBE
Revision 1.0Apr 5, 2023Provider: repository / Type: Initial release
Revision 1.1Apr 26, 2023Group: Database references / Category: citation / citation_author
Item: _citation.journal_volume / _citation.page_first ..._citation.journal_volume / _citation.page_first / _citation.page_last / _citation_author.identifier_ORCID
Revision 1.2Feb 7, 2024Group: Data collection / Refinement description
Category: chem_comp_atom / chem_comp_bond / pdbx_initial_refinement_model
Revision 1.3Oct 23, 2024Group: Structure summary / Category: pdbx_entry_details / pdbx_modification_feature / Item: _pdbx_entry_details.has_protein_modification

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: Leptin receptor
B: Leptin receptor
C: anti-mLEPR VHH 4-80
D: anti-mLEPR VHH 4-80
hetero molecules


Theoretical massNumber of molelcules
Total (without water)78,57018
Polymers76,7254
Non-polymers1,84514
Water9,260514
1
A: Leptin receptor
C: anti-mLEPR VHH 4-80
hetero molecules


Theoretical massNumber of molelcules
Total (without water)39,38110
Polymers38,3622
Non-polymers1,0198
Water362
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area3710 Å2
ΔGint-66 kcal/mol
Surface area15730 Å2
MethodPISA
2
B: Leptin receptor
D: anti-mLEPR VHH 4-80
hetero molecules


Theoretical massNumber of molelcules
Total (without water)39,1898
Polymers38,3622
Non-polymers8276
Water362
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area3120 Å2
ΔGint-40 kcal/mol
Surface area16080 Å2
MethodPISA
Unit cell
Length a, b, c (Å)53.192, 85.876, 144.689
Angle α, β, γ (deg.)90, 90, 90
Int Tables number19
Space group name H-MP212121

-
Components

#1: Protein Leptin receptor / LEP-R / B219 / OB receptor / OB-R


Mass: 22779.152 Da / Num. of mol.: 2 / Mutation: N668Q, N698Q, N726Q
Source method: isolated from a genetically manipulated source
Details: This sequence corresponds to the membrane proximal FnIII module of the mouse leptin receptor (mLEP-R, residues 633 to 827). To facilitate crystallization, three Asn residues were mutated ...Details: This sequence corresponds to the membrane proximal FnIII module of the mouse leptin receptor (mLEP-R, residues 633 to 827). To facilitate crystallization, three Asn residues were mutated (N668Q, N698Q, N726Q). This FnIII module was co-expressed and co-purified with a His-tagged anti-mLEP-R nanobody (VHH 4.11). Prior to crystallisation experiments, the protein complex was deglycosylated with EndoH. Cys751 of mLEP-R was found to be oxidized and modelled as hydroxycysteine residue (CSO).
Source: (gene. exp.) Mus musculus (house mouse) / Gene: Lepr, Db, Obr / Plasmid: pHLsec
Details (production host): Aricescu et al., ActaCrystD, 2006
Cell line (production host): HEK293 / Production host: Homo sapiens (human) / Variant (production host): FreeStyle cells / References: UniProt: P48356
#2: Antibody anti-mLEPR VHH 4-80


Mass: 15583.163 Da / Num. of mol.: 2
Source method: isolated from a genetically manipulated source
Details: ETGQVQLQESGGGLVQPGGSLRLSCAASGFTLDDYGIAWFRQAPGKEREGVSCISTSDDSTYYADSVKGRFTISRDTAKNTVYLQMNSLKPEDTAVYYCAAERAPMCYSRSYYLVDYGMDYWGKGTQVTVSSGTKHHHHHH
Source: (gene. exp.) Lama glama (llama) / Plasmid: pHLsec / Cell line (production host): HEK293 / Production host: Homo sapiens (human) / Variant (production host): FreeStyle
#3: Sugar
ChemComp-NAG / 2-acetamido-2-deoxy-beta-D-glucopyranose / N-acetyl-beta-D-glucosamine / 2-acetamido-2-deoxy-beta-D-glucose / 2-acetamido-2-deoxy-D-glucose / 2-acetamido-2-deoxy-glucose / N-ACETYL-D-GLUCOSAMINE


Type: D-saccharide, beta linking / Mass: 221.208 Da / Num. of mol.: 4 / Source method: obtained synthetically / Formula: C8H15NO6
IdentifierTypeProgram
DGlcpNAcbCONDENSED IUPAC CARBOHYDRATE SYMBOLGMML 1.0
N-acetyl-b-D-glucopyranosamineCOMMON NAMEGMML 1.0
b-D-GlcpNAcIUPAC CARBOHYDRATE SYMBOLPDB-CARE 1.0
GlcNAcSNFG CARBOHYDRATE SYMBOLGMML 1.0
#4: Chemical
ChemComp-SO4 / SULFATE ION


Mass: 96.063 Da / Num. of mol.: 10 / Source method: obtained synthetically / Formula: SO4
#5: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 514 / Source method: isolated from a natural source / Formula: H2O
Has ligand of interestN
Has protein modificationY

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 2.15 Å3/Da / Density % sol: 42.89 %
Crystal growTemperature: 293 K / Method: vapor diffusion, sitting drop / pH: 5.6
Details: 0.2 M ammonium sulphate 0.1 M Na cacodylate pH 5.6 30% PEG Smear Medium
Temp details: Temperature-controlled cabinet

-
Data collection

DiffractionMean temperature: 100 K / Ambient temp details: Cryostream 800 series / Serial crystal experiment: N
Diffraction sourceSource: SYNCHROTRON / Site: PETRA III, EMBL c/o DESY / Beamline: P13 (MX1) / Wavelength: 0.972418 Å
DetectorType: DECTRIS EIGER X 16M / Detector: PIXEL / Date: May 12, 2022 / Details: adaptive KB-mirrors
RadiationMonochromator: Si(111) or Si(311); both crystals LN2 cooled / Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 0.972418 Å / Relative weight: 1
ReflectionResolution: 1.75→90 Å / Num. obs: 67680 / % possible obs: 100 % / Observed criterion σ(I): -3 / Redundancy: 11.9 % / Biso Wilson estimate: 32.147 Å2 / CC1/2: 0.998 / Rrim(I) all: 0.164 / Net I/av σ(I): 10.48 / Net I/σ(I): 10.48
Reflection shellResolution: 1.75→1.86 Å / Redundancy: 11.5 % / Mean I/σ(I) obs: 0.86 / Num. unique obs: 10778 / CC1/2: 0.326 / Rrim(I) all: 2.066 / % possible all: 99.9

-
Processing

Software
NameVersionClassification
BUSTER2.10.4 (3-FEB-2022)refinement
XDSVERSION Jan 10, 2022 BUILT=20220220data reduction
Aimlessversion 0.7.7data scaling
PHASERversion 2.8.3phasing
RefinementMethod to determine structure: MOLECULAR REPLACEMENT
Starting model: 1OHQ, AF-P48356-F1-model_v1
Resolution: 1.75→25.42 Å / Cor.coef. Fo:Fc: 0.961 / Cor.coef. Fo:Fc free: 0.943 / SU R Cruickshank DPI: 0.123 / Cross valid method: THROUGHOUT / SU R Blow DPI: 0.131 / SU Rfree Blow DPI: 0.124 / SU Rfree Cruickshank DPI: 0.12
RfactorNum. reflection% reflectionSelection details
Rfree0.2333 3373 5 %RANDOM
Rwork0.1934 ---
obs0.1953 67651 100 %-
Displacement parametersBiso mean: 38.46 Å2
Baniso -1Baniso -2Baniso -3
1-1.6091 Å20 Å20 Å2
2---2.2495 Å20 Å2
3---0.6404 Å2
Refine analyzeLuzzati coordinate error obs: 0.24 Å
Refinement stepCycle: LAST / Resolution: 1.75→25.42 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms5131 0 106 514 5751
Refine LS restraints
Refine-IDTypeDev idealNumberRestraint functionWeight
X-RAY DIFFRACTIONt_bond_d0.0085531HARMONIC2
X-RAY DIFFRACTIONt_angle_deg0.937546HARMONIC2
X-RAY DIFFRACTIONt_dihedral_angle_d1885SINUSOIDAL2
X-RAY DIFFRACTIONt_gen_planes922HARMONIC5
X-RAY DIFFRACTIONt_it5531HARMONIC10
X-RAY DIFFRACTIONt_chiral_improper_torsion705SEMIHARMONIC5
X-RAY DIFFRACTIONt_sum_occupancies16HARMONIC1
X-RAY DIFFRACTIONt_ideal_dist_contact5000SEMIHARMONIC4
X-RAY DIFFRACTIONt_omega_torsion3.71
X-RAY DIFFRACTIONt_other_torsion15.69
LS refinement shellResolution: 1.75→1.76 Å
RfactorNum. reflection% reflection
Rfree0.4167 58 -
Rwork0.4067 --
obs0.4071 1354 99.26 %
Refinement TLS params.

Refine-ID: X-RAY DIFFRACTION

IDL112)L122)L132)L222)L232)L332)S11 (Å °)S12 (Å °)S13 (Å °)S21 (Å °)S22 (Å °)S23 (Å °)S31 (Å °)S32 (Å °)S33 (Å °)T112)T122)T132)T222)T232)T332)Origin x (Å)Origin y (Å)Origin z (Å)
11.0965-0.4741-0.26231.3821-0.06265.8203-0.1970.2620.24490.2620.03770.40120.24490.40120.15920.02980.0253-0.0066-0.03310.0158-0.035122.483716.722328.4817
22.5127-0.2894-1.12773.2939-2.06573.6902-0.12530.6989-0.19630.6989-0.05430.4859-0.19630.48590.17960.10990.0281-0.0803-0.00350.0259-0.019926.483113.061935.9606
32.3625-0.5637-0.3592.6877-0.14753.5714-0.19810.28510.37610.28510.08930.0450.37610.0450.10880.03820.03260.0266-0.10020.0293-0.041221.57458.511731.2949
41.302-0.35941.13123.90351.70832.0667-0.1201-0.0737-0.2123-0.07370.1118-0.0575-0.2123-0.05750.0083-0.0229-0.00210.0193-0.0195-0.02390.020418.344731.682925.6701
55.60712.811.29296.50750.31263.63760.05190.0666-0.10810.0666-0.045-0.0838-0.1081-0.0838-0.007-0.0597-0.0048-0.0321-0.10770.012-0.04121.532229.631828.7778
62.30911.37220.45915.4037-0.17472.6771-0.0918-0.0836-0.2924-0.08360.03310.2743-0.29240.27430.0587-0.0003-0.0202-0.0047-0.0154-0.00340.045824.922432.358623.4904
71.1987-0.1188-0.83760.0189-0.4319.0641-0.26560.00750.44630.0075-0.0646-0.33220.4463-0.33220.33010.0349-0.06410.0568-0.0314-0.0511-0.02830.871614.656540.3619
83.8592-0.084-1.03893.9430.96678.4769-0.3936-0.37930.9417-0.3793-0.1016-0.70110.9417-0.70110.49520.0692-0.13060.1732-0.1592-0.093-0.0642-1.02818.708339.5006
90.77-0.4832-0.75221.51190.6031.5793-0.0228-0.1591-0.0127-0.1591-0.0435-0.0823-0.0127-0.08230.0663-0.03080.01330.0555-0.0516-0.0023-0.0233.278924.787742.1938
103.4788-2.6122-0.66614.2542-0.35942.8719-0.00810.0621-0.11740.06210.0784-0.2991-0.1174-0.2991-0.0703-0.04980.01910.0402-0.0467-0.0022-0.0162-3.742330.402445.2413
116.892-3.769-3.34087.71642.63734.13330.1956-0.4049-0.2693-0.4049-0.1283-0.4693-0.2693-0.4693-0.0673-0.1352-0.0011-0.03710.13370.0765-0.177418.029226.5249-10.2313
122.4074-0.9334-4.93050.31123.591710.17640.1020.14570.1130.14570.085-0.24040.113-0.2404-0.187-0.08130.0014-0.00860.0870.1046-0.021220.545331.3087-7.1551
134.1315-1.8254-1.14245.00152.42293.1241-0.0172-0.3163-0.5884-0.31630.0286-0.1717-0.5884-0.1717-0.01140.01060.0291-0.02620.0350.05370.006415.622230.49343.0801
145.02210.89020.94241.35840.86963.52860.10920.14520.06410.14520.0648-0.07310.0641-0.0731-0.174-0.0566-0.0084-0.00030.02480.0364-0.064419.294322.47273.5217
153.0393-0.93170.09711.4304-0.58822.2533-0.01210.0728-0.17860.0728-0.02070.0325-0.17860.03250.0328-0.0386-0.0247-0.00580.02760.0426-0.01325.504927.424-0.9186
167.18750.9451-2.0272.0509-0.2682.7621-0.03360.13940.11330.1394-0.1211-0.26330.1133-0.26330.1547-0.0842-0.0243-0.00540.0958-0.0287-0.020125.747615.2254-9.4031
173.0377-1.4077-1.14112.43591.09864.0980.02520.0447-0.17130.0447-0.1029-0.371-0.1713-0.3710.0777-0.0823-0.0123-0.00580.06170.0305-0.039514.158225.4930.4699
181.8693-0.0237-0.41640.47160.27782.0138-0.00490.0536-0.0620.05360.0336-0.1902-0.062-0.1902-0.0287-0.0431-0.0057-0.00910.03740.0131-0.034315.715523.32543.1814
194.23222.3195-2.6127.5933-4.7667.16690.36090.5223-0.41870.5223-0.47260.8655-0.41870.86550.1117-0.184-0.0256-0.00390.2691-0.1051-0.27340.786124.527481.3147
207.12821.3463-1.58173.0157-3.20178.31-0.01540.8447-1.35230.8447-0.0610.4305-1.35230.43050.0764-0.0107-0.0201-0.03630.0646-0.0617-0.07354.256128.409769.0597
2113.0956-0.6213-0.92031.47761.66227.0034-0.41250.38530.47190.38530.33870.370.47190.370.0738-0.02230.04930.02820.13680.05360.03845.607515.310171.6789
224.50624.2145-3.16899.4899-6.39836.8836-0.1231-0.35210.1326-0.35210.096-0.44680.1326-0.44680.027-0.07270.04180.00640.0567-0.0738-0.0935-6.272920.090966.2053
236.91842.71430.636810.1437-0.05895.040.0878-0.1497-0.5331-0.1497-0.1757-0.1578-0.5331-0.15780.0879-0.07620.04190.03910.0748-0.1512-0.0647-4.706128.721374.1429
246.21473.4398-4.20372.6463-2.7847.4129-0.032-0.00930.0844-0.0093-0.32070.52770.08440.52770.3526-0.16870.1059-0.00530.12250.0391-0.11971.700517.818275.6793
253.19211.0586-1.50760.5828-0.47792.8127-0.0266-0.06760.0069-0.0676-0.08970.24690.00690.24690.1163-0.05790.04060.00080.10260.0193-0.04195.023721.139868.241
268.05676.096-4.05268.76885.03651.0176-0.2076-0.24480.4092-0.24480.55050.92710.40920.9271-0.34290.13140.15430.01230.0499-0.0431-0.02229.29478.639114.116
270.6804-1.29060.52840.36150.202400.0196-0.16930.1305-0.16930.00690.07280.13050.0728-0.02650.3044-0.01750.07961.00020.02710.784616.70311.257618.363
289.341-4.9127-5.06234.66444.2580.45560.0455-0.6120.3873-0.6120.1348-0.3250.3873-0.325-0.18030.4839-0.30160.28390.01580.0622-0.0476-5.20795.32456.6881
290-0.6738-0.02911.3253-0.84870-0.03640.04850.12760.04850.02030.22430.12760.22430.01610.1772-0.01330.2994-0.10540.23760.19945.5241.201452.2591
301.2826-0.5904-0.61621.8123-0.2853.4197-0.3587-0.12040.2907-0.12040.13660.1330.29070.1330.2221-0.3306-0.0488-0.266-0.3095-0.1252-0.189814.145916.405333.6679
Refinement TLS group
IDRefine-IDRefine TLS-IDSelection detailsAuth asym-IDAuth seq-ID
1X-RAY DIFFRACTION1{ A|636 - A|655 }A636 - 655
2X-RAY DIFFRACTION2{ A|656 - A|683 }A656 - 683
3X-RAY DIFFRACTION3{ A|684 - A|725 }A684 - 725
4X-RAY DIFFRACTION4{ A|726 - A|758 }A726 - 758
5X-RAY DIFFRACTION5{ A|759 - A|796 }A759 - 796
6X-RAY DIFFRACTION6{ A|797 - A|827 }A797 - 827
7X-RAY DIFFRACTION7{ B|632 - B|655 }B632 - 655
8X-RAY DIFFRACTION8{ B|656 - B|707 }B656 - 707
9X-RAY DIFFRACTION9{ B|708 - B|774 }B708 - 774
10X-RAY DIFFRACTION10{ B|775 - B|827 }B775 - 827
11X-RAY DIFFRACTION11{ C|4 - C|20 }C4 - 20
12X-RAY DIFFRACTION12{ C|21 - C|28 }C21 - 28
13X-RAY DIFFRACTION13{ C|29 - C|42 }C29 - 42
14X-RAY DIFFRACTION14{ C|43 - C|60 }C43 - 60
15X-RAY DIFFRACTION15{ C|61 - C|86 }C61 - 86
16X-RAY DIFFRACTION16{ C|87 - C|94 }C87 - 94
17X-RAY DIFFRACTION17{ C|95 - C|103 }C95 - 103
18X-RAY DIFFRACTION18{ C|104 - C|132 }C104 - 132
19X-RAY DIFFRACTION19{ D|5 - D|28 }D5 - 28
20X-RAY DIFFRACTION20{ D|29 - D|42 }D29 - 42
21X-RAY DIFFRACTION21{ D|43 - D|54 }D43 - 54
22X-RAY DIFFRACTION22{ D|55 - D|70 }D55 - 70
23X-RAY DIFFRACTION23{ D|71 - D|86 }D71 - 86
24X-RAY DIFFRACTION24{ D|87 - D|103 }D87 - 103
25X-RAY DIFFRACTION25{ D|104 - D|132 }D104 - 132
26X-RAY DIFFRACTION26{ E|657 - E|657 }E657
27X-RAY DIFFRACTION27{ E|686 - E|686 }E686
28X-RAY DIFFRACTION28{ F|657 - F|657 }F657
29X-RAY DIFFRACTION29{ F|686 - F|686 }F686
30X-RAY DIFFRACTION30{ L|1 - L|10 }L1 - 10

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more