[English] 日本語
Yorodumi- PDB-7lx0: Quantitative assessment of chlorophyll types in cryo-EM maps of p... -
+
Open data
-
Basic information
| Entry | Database: PDB / ID: 7lx0 | ||||||
|---|---|---|---|---|---|---|---|
| Title | Quantitative assessment of chlorophyll types in cryo-EM maps of photosystem I acclimated to far-red light | ||||||
Components |
| ||||||
Keywords | PHOTOSYNTHESIS / Photosystem I / Far-red light / Chlorophyll f | ||||||
| Function / homology | Function and homology information: / photosystem I reaction center / photosystem I / photosynthetic electron transport in photosystem I / photosystem I / plasma membrane-derived thylakoid membrane / chlorophyll binding / membrane => GO:0016020 / photosynthesis / endomembrane system ...: / photosystem I reaction center / photosystem I / photosynthetic electron transport in photosystem I / photosystem I / plasma membrane-derived thylakoid membrane / chlorophyll binding / membrane => GO:0016020 / photosynthesis / endomembrane system / 4 iron, 4 sulfur cluster binding / oxidoreductase activity / electron transfer activity / magnesium ion binding / metal ion binding / membrane Similarity search - Function | ||||||
| Biological species | Fischerella thermalis PCC 7521 (bacteria) | ||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 2.96 Å | ||||||
Authors | Gisriel, C.J. / Wang, J. | ||||||
| Funding support | United States, 1items
| ||||||
Citation | Journal: BBA Adv / Year: 2021Title: Quantitative assessment of chlorophyll types in cryo-EM maps of photosystem I acclimated to far-red light Authors: Gisriel, C.J. / Huang, H.L. / Reiss, K.M. / Flesher, D.A. / Batista, V.S. / Bryant, D.A. / Brudvig, G.W. / Wang, J. | ||||||
| History |
|
-
Structure visualization
| Movie |
Movie viewer |
|---|---|
| Structure viewer | Molecule: Molmil Jmol/JSmol |
-
Downloads & links
-
Download
| PDBx/mmCIF format | 7lx0.cif.gz | 1.5 MB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb7lx0.ent.gz | 1.4 MB | Display | PDB format |
| PDBx/mmJSON format | 7lx0.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/lx/7lx0 ftp://data.pdbj.org/pub/pdb/validation_reports/lx/7lx0 | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 23563MC M: map data used to model this data C: citing same article ( |
|---|---|
| Similar structure data |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
-
Components
-Photosystem I ... , 10 types, 30 molecules GaAHbBNcCOdDPeEQfFRiISjJTkKVmM
| #1: Protein | Mass: 87627.914 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Fischerella thermalis PCC 7521 (bacteria) / References: UniProt: G6FME9, photosystem I#2: Protein | Mass: 83450.969 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Fischerella thermalis PCC 7521 (bacteria) / References: UniProt: A0A2N6KXB6, photosystem I#3: Protein | Mass: 8853.221 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Fischerella thermalis PCC 7521 (bacteria) / References: UniProt: G6FW50, photosystem I#4: Protein | Mass: 17776.348 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Fischerella thermalis PCC 7521 (bacteria) / References: UniProt: G6FW99#5: Protein | Mass: 8070.138 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Fischerella thermalis PCC 7521 (bacteria) / References: UniProt: G6FQU3#6: Protein | Mass: 17788.021 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Fischerella thermalis PCC 7521 (bacteria) / References: UniProt: G6FMD3#7: Protein | Mass: 7735.956 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Fischerella thermalis PCC 7521 (bacteria) / References: UniProt: A0A2N6MR25#8: Protein/peptide | Mass: 5435.492 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Fischerella thermalis PCC 7521 (bacteria) / References: UniProt: G6FMD2#9: Protein/peptide | Mass: 4494.526 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Fischerella thermalis PCC 7521 (bacteria)#11: Protein/peptide | Mass: 3471.115 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Fischerella thermalis PCC 7521 (bacteria) / References: UniProt: G6FWT6 |
|---|
-Protein , 2 types, 6 molecules UlLWxX
| #10: Protein | Mass: 18543.229 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Fischerella thermalis PCC 7521 (bacteria) / References: UniProt: A0A2N6L446#12: Protein | Mass: 11132.814 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Fischerella thermalis PCC 7521 (bacteria) / References: UniProt: G6FSH2 |
|---|
-Sugars , 1 types, 6 molecules 
| #21: Sugar | ChemComp-LMT / |
|---|
-Non-polymers , 9 types, 366 molecules 














| #13: Chemical | | #14: Chemical | ChemComp-CLA / #15: Chemical | ChemComp-F6C / #16: Chemical | ChemComp-PQN / #17: Chemical | ChemComp-SF4 / #18: Chemical | ChemComp-BCR / #19: Chemical | ChemComp-LHG / #20: Chemical | ChemComp-LMG / #22: Chemical | |
|---|
-Details
| Has ligand of interest | Y |
|---|---|
| Has protein modification | Y |
| Sequence details | The full sequence of PsaK is MSSILLAAAATVPPTAEWSPKVALIISISCLVAVLLSFRIEKPKVGPKMPGLPLSIPTFV ...The full sequence of PsaK is MSSILLAAAA |
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component | Name: Photosystem I adapted to far-red light / Type: COMPLEX / Entity ID: #1-#12 / Source: NATURAL |
|---|---|
| Source (natural) | Organism: Fischerella thermalis PCC 7521 (bacteria) |
| Buffer solution | pH: 7 |
| Specimen | Conc.: 1.5 mg/ml / Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES |
| Specimen support | Grid material: COPPER / Grid mesh size: 300 divisions/in. / Grid type: C-flat-1.2/1.3 |
| Vitrification | Cryogen name: ETHANE |
-
Electron microscopy imaging
| Experimental equipment | ![]() Model: Titan Krios / Image courtesy: FEI Company |
|---|---|
| Microscopy | Model: FEI TITAN KRIOS |
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: FLOOD BEAM |
| Electron lens | Mode: BRIGHT FIELD |
| Image recording | Electron dose: 57.328 e/Å2 / Film or detector model: GATAN K2 SUMMIT (4k x 4k) |
-
Processing
| CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION |
|---|---|
| 3D reconstruction | Resolution: 2.96 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 201104 / Symmetry type: POINT |
Movie
Controller
About Yorodumi



Fischerella thermalis PCC 7521 (bacteria)
United States, 1items
Citation
UCSF Chimera










PDBj











