[English] 日本語
Yorodumi- PDB-7jpi: Crystal structure of EBOV glycoprotein with modified HR2 stalk at... -
+
Open data
-
Basic information
| Entry | Database: PDB / ID: 7jpi | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Title | Crystal structure of EBOV glycoprotein with modified HR2 stalk at 2.3A resolution | |||||||||
Components | (Envelope glycoprotein) x 2 | |||||||||
Keywords | VIRAL PROTEIN / Ebola glycoprotein | |||||||||
| Function / homology | Function and homology informationsymbiont-mediated killing of host cell / host cell endoplasmic reticulum / viral budding from plasma membrane / clathrin-dependent endocytosis of virus by host cell / symbiont-mediated-mediated suppression of host tetherin activity / host cell cytoplasm / entry receptor-mediated virion attachment to host cell / symbiont-mediated suppression of host innate immune response / membrane raft / fusion of virus membrane with host endosome membrane ...symbiont-mediated killing of host cell / host cell endoplasmic reticulum / viral budding from plasma membrane / clathrin-dependent endocytosis of virus by host cell / symbiont-mediated-mediated suppression of host tetherin activity / host cell cytoplasm / entry receptor-mediated virion attachment to host cell / symbiont-mediated suppression of host innate immune response / membrane raft / fusion of virus membrane with host endosome membrane / viral envelope / symbiont entry into host cell / lipid binding / host cell plasma membrane / virion membrane / extracellular region / identical protein binding Similarity search - Function | |||||||||
| Biological species | ![]() ![]() 1976 | |||||||||
| Method | X-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 2.28 Å | |||||||||
Authors | Chaudhary, A. / Stanfield, R.L. / Wilson, I.A. / Zhu, J. | |||||||||
| Funding support | United States, 2items
| |||||||||
Citation | Journal: Nat Commun / Year: 2021Title: Single-component multilayered self-assembling nanoparticles presenting rationally designed glycoprotein trimers as Ebola virus vaccines. Authors: He, L. / Chaudhary, A. / Lin, X. / Sou, C. / Alkutkar, T. / Kumar, S. / Ngo, T. / Kosviner, E. / Ozorowski, G. / Stanfield, R.L. / Ward, A.B. / Wilson, I.A. / Zhu, J. | |||||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 7jpi.cif.gz | 107.7 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb7jpi.ent.gz | 73.2 KB | Display | PDB format |
| PDBx/mmJSON format | 7jpi.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/jp/7jpi ftp://data.pdbj.org/pub/pdb/validation_reports/jp/7jpi | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 7jphC ![]() 5jq3S S: Starting model for refinement C: citing same article ( |
|---|---|
| Similar structure data |
-
Links
-
Assembly
| Deposited unit | ![]()
| ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | ![]()
| ||||||||||||
| Unit cell |
|
-
Components
-Protein , 2 types, 2 molecules AB
| #1: Protein | Mass: 33246.555 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() Homo sapiens (human) |
|---|---|
| #2: Protein | Mass: 18498.977 Da / Num. of mol.: 1 / Mutation: W615L Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() Homo sapiens (human) / References: UniProt: Q05320 |
-Sugars , 3 types, 4 molecules 
| #3: Polysaccharide | Source method: isolated from a genetically manipulated source #4: Polysaccharide | alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D- ...alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose | Source method: isolated from a genetically manipulated source #6: Sugar | ChemComp-NAG / | |
|---|
-Non-polymers , 3 types, 141 molecules 




| #5: Chemical | | #7: Chemical | ChemComp-PO4 / | #8: Water | ChemComp-HOH / | |
|---|
-Details
| Has ligand of interest | N |
|---|---|
| Has protein modification | Y |
| Sequence details | The complete sequence of chain A is IPLGVIHNSALQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGV ...The complete sequence of chain A is IPLGVIHNSA |
-Experimental details
-Experiment
| Experiment | Method: X-RAY DIFFRACTION / Number of used crystals: 1 |
|---|
-
Sample preparation
| Crystal | Density Matthews: 4.79 Å3/Da / Density meas: 74.31 Mg/m3 / Density % sol: 43.42 % |
|---|---|
| Crystal grow | Temperature: 293 K / Method: vapor diffusion, sitting drop / pH: 5 / Details: 0.M Sodium citrate, 10% PEG w/v 6000 |
-Data collection
| Diffraction | Mean temperature: 100 K / Serial crystal experiment: N |
|---|---|
| Diffraction source | Source: SYNCHROTRON / Site: APS / Beamline: 23-ID-D / Wavelength: 1 Å |
| Detector | Type: DECTRIS PILATUS3 6M / Detector: PIXEL / Date: Mar 6, 2020 |
| Radiation | Monochromator: M / Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray |
| Radiation wavelength | Wavelength: 1 Å / Relative weight: 1 |
| Reflection | Resolution: 2.28→49.05 Å / Num. obs: 34904 / % possible obs: 96.4 % / Redundancy: 4.5 % / Biso Wilson estimate: 44.36 Å2 / CC1/2: 0.781 / Net I/σ(I): 8 |
| Reflection shell | Resolution: 2.28→2.34 Å / Mean I/σ(I) obs: 0.9 / Num. unique obs: 1725 / CC1/2: 0.325 / % possible all: 97.3 |
-
Processing
| Software |
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Refinement | Method to determine structure: MOLECULAR REPLACEMENTStarting model: 5JQ3 Resolution: 2.28→49 Å / SU ML: 0.3159 / Cross valid method: FREE R-VALUE / σ(F): 1.34 / Phase error: 25.4449 Stereochemistry target values: GeoStd + Monomer Library + CDL v1.2
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Solvent computation | Shrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å / Solvent model: FLAT BULK SOLVENT MODEL | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Displacement parameters | Biso mean: 58.37 Å2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement step | Cycle: LAST / Resolution: 2.28→49 Å
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refine LS restraints |
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| LS refinement shell |
|
Movie
Controller
About Yorodumi




X-RAY DIFFRACTION
United States, 2items
Citation









PDBj



Homo sapiens (human)