+
Open data
-
Basic information
| Entry | Database: PDB / ID: 6foc | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Title | F1-ATPase from Mycobacterium smegmatis | |||||||||||||||
Components | (ATP synthase ...) x 4 | |||||||||||||||
Keywords | HYDROLASE / Complex / Mycobacteria | |||||||||||||||
| Function / homology | Function and homology informationproton motive force-driven plasma membrane ATP synthesis / H+-transporting two-sector ATPase / proton-transporting ATP synthase complex / proton-transporting ATP synthase activity, rotational mechanism / ADP binding / ATP binding / plasma membrane Similarity search - Function | |||||||||||||||
| Biological species | Mycolicibacterium smegmatis MC2 155 (bacteria) Mycobacterium smegmatis str. MC2 155 (bacteria) | |||||||||||||||
| Method | X-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / molecular replacement / Resolution: 4 Å | |||||||||||||||
Authors | Zhang, T. / Montgomery, M.G. / Leslie, A.G.W. / Cook, G.M. / Walker, J.E. | |||||||||||||||
| Funding support | United Kingdom, 4items
| |||||||||||||||
Citation | Journal: Proc.Natl.Acad.Sci.USA / Year: 2019Title: The structure of the catalytic domain of the ATP synthase fromMycobacterium smegmatisis a target for developing antitubercular drugs. Authors: Zhang, A.T. / Montgomery, M.G. / Leslie, A.G.W. / Cook, G.M. / Walker, J.E. | |||||||||||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 6foc.cif.gz | 594.7 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb6foc.ent.gz | 479.1 KB | Display | PDB format |
| PDBx/mmJSON format | 6foc.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/fo/6foc ftp://data.pdbj.org/pub/pdb/validation_reports/fo/6foc | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 5hkkS S: Starting model for refinement |
|---|---|
| Similar structure data |
-
Links
-
Assembly
| Deposited unit | ![]()
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Unit cell |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Noncrystallographic symmetry (NCS) | NCS domain:
NCS domain segments: Component-ID: _ / Refine code: _
NCS ensembles :
|
-
Components
-ATP synthase ... , 4 types, 8 molecules ABCDEFGH
| #1: Protein | Mass: 58870.578 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Details: We are uncertain as to the register after residue 511 and so have built as UNK and numbered 1001-1011. These 11 residues are probably 512-522 but the resolution is not succinctly good to be ...Details: We are uncertain as to the register after residue 511 and so have built as UNK and numbered 1001-1011. These 11 residues are probably 512-522 but the resolution is not succinctly good to be certain. The complete sequence is MAELTISAADIEGAIEDYVSSFSADTEREEIGTVIDAGDGIAHVEGLPSVMTQELLEFPG GVLGVALNLDEHSVGAVILGEFEKIEEGQQVKRTGEVLSVPVGDAFLGRVVNPLGQPIDG QGDIAAETRRALELQAPSVVQRQSVSEPLQTGIKAIDAMTPIGRGQRQLIIGDRKTGKTA VCVDTILNQREAWLTGDPKQQVRCVYVAIGQKGTTIASVKRALEEGGAMEYTTIVAAPAS DAAGFKWLAPYTGSAIGQHWMYNGKHVLIVFDDLSKQADAYRAISLLLRRPPGREAFPGD VFYLHSRLLERCAKLSDELGGGSMTGLPIIETKANDISAFIPTNVISITDGQCFLESDLF NQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDLSQYRELEAFAAFASDLDAASKAQ LDRGARLVELLKQPQYSPLAVEEQVVAIFLGTQGHLDSVPVEDVQRFESELLEHVKASHS DIFDGIRETKKLSEEAEEKLVSVINEFKKGFQASDGSSVVVSENAEALDPEDLEKESVKV RKPAPKKA,We are uncertain as to the register after residue 511 and so have built as UNK and numbered 1001-1011. These 11 residues are probably 512-522 but the resolution is not succinctly good to be certain. The complete sequence is MAELTISAADIEGAIEDYVSSFSADTEREEIGTVIDAGDGIAHVEGLPSVMTQELLEFPG GVLGVALNLDEHSVGAVILGEFEKIEEGQQVKRTGEVLSVPVGDAFLGRVVNPLGQPIDG QGDIAAETRRALELQAPSVVQRQSVSEPLQTGIKAIDAMTPIGRGQRQLIIGDRKTGKTA VCVDTILNQREAWLTGDPKQQVRCVYVAIGQKGTTIASVKRALEEGGAMEYTTIVAAPAS DAAGFKWLAPYTGSAIGQHWMYNGKHVLIVFDDLSKQADAYRAISLLLRRPPGREAFPGD VFYLHSRLLERCAKLSDELGGGSMTGLPIIETKANDISAFIPTNVISITDGQCFLESDLF NQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDLSQYRELEAFAAFASDLDAASKAQ LDRGARLVELLKQPQYSPLAVEEQVVAIFLGTQGHLDSVPVEDVQRFESELLEHVKASHS DIFDGIRETKKLSEEAEEKLVSVINEFKKGFQASDGSSVVVSENAEALDPEDLEKESVKV RKPAPKKA,We are uncertain as to the register after residue 511 and so have built as UNK and numbered 1001-1011. These 11 residues are probably 512-522 but the resolution is not succinctly good to be certain. The complete sequence is MAELTISAADIEGAIEDYVSSFSADTEREEIGTVIDAGDGIAHVEGLPSVMTQELLEFPG GVLGVALNLDEHSVGAVILGEFEKIEEGQQVKRTGEVLSVPVGDAFLGRVVNPLGQPIDG QGDIAAETRRALELQAPSVVQRQSVSEPLQTGIKAIDAMTPIGRGQRQLIIGDRKTGKTA VCVDTILNQREAWLTGDPKQQVRCVYVAIGQKGTTIASVKRALEEGGAMEYTTIVAAPAS DAAGFKWLAPYTGSAIGQHWMYNGKHVLIVFDDLSKQADAYRAISLLLRRPPGREAFPGD VFYLHSRLLERCAKLSDELGGGSMTGLPIIETKANDISAFIPTNVISITDGQCFLESDLF NQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDLSQYRELEAFAAFASDLDAASKAQ LDRGARLVELLKQPQYSPLAVEEQVVAIFLGTQGHLDSVPVEDVQRFESELLEHVKASHS DIFDGIRETKKLSEEAEEKLVSVINEFKKGFQASDGSSVVVSENAEALDPEDLEKESVKV RKPAPKKA,We are uncertain as to the register after residue 511 and so have built as UNK and numbered 1512-1522. These 11 residues are probably 512-522 but the resolution is not succinctly good to be certain. The complete sequence is MAELTISAADIEGAIEDYVSSFSADTEREEIGTVIDAGDGIAHVEGLPSVMTQELLEFPG GVLGVALNLDEHSVGAVILGEFEKIEEGQQVKRTGEVLSVPVGDAFLGRVVNPLGQPIDG QGDIAAETRRALELQAPSVVQRQSVSEPLQTGIKAIDAMTPIGRGQRQLIIGDRKTGKTA VCVDTILNQREAWLTGDPKQQVRCVYVAIGQKGTTIASVKRALEEGGAMEYTTIVAAPAS DAAGFKWLAPYTGSAIGQHWMYNGKHVLIVFDDLSKQADAYRAISLLLRRPPGREAFPGD VFYLHSRLLERCAKLSDELGGGSMTGLPIIETKANDISAFIPTNVISITDGQCFLESDLF NQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDLSQYRELEAFAAFASDLDAASKAQ LDRGARLVELLKQPQYSPLAVEEQVVAIFLGTQGHLDSVPVEDVQRFESELLEHVKASHS DIFDGIRETKKLSEEAEEKLVSVINEFKKGFQASDGSSVVVSENAEALDPEDLEKESVKV RKPAPKKA Source: (gene. exp.) Mycolicibacterium smegmatis MC2 155 (bacteria), (gene. exp.) Mycobacterium smegmatis str. MC2 155 (bacteria)Gene: atpA, MSMEG_4938, MSMEI_4811 Production host: Mycolicibacterium smegmatis MC2 155 (bacteria)Variant (production host): 4517 References: UniProt: A0R202, H+-transporting two-sector ATPase #2: Protein | Mass: 51670.453 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Details: The N-terminus contains a hexaHis tag followed by a TEV site. Post-cleavage, GTATA would be the start of the mature protein. Source: (gene. exp.) Mycolicibacterium smegmatis MC2 155 (bacteria)Gene: atpD, MSMEG_4936, MSMEI_4809 Production host: Mycolicibacterium smegmatis MC2 155 (bacteria)Variant (production host): 4517 References: UniProt: A0R200, H+-transporting two-sector ATPase #3: Protein | | Mass: 33439.836 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Mycolicibacterium smegmatis MC2 155 (bacteria)Gene: atpG, MSMEG_4937, MSMEI_4810 Production host: Mycolicibacterium smegmatis MC2 155 (bacteria)Variant (production host): 4517 / References: UniProt: A0R201 #4: Protein | | Mass: 13277.741 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Mycolicibacterium smegmatis MC2 155 (bacteria)Gene: atpC, MSMEG_4935, MSMEI_4808 Production host: Mycolicibacterium smegmatis MC2 155 (bacteria)Variant (production host): 4517 / References: UniProt: A0R1Z9 |
|---|
-Non-polymers , 4 types, 31 molecules 






| #5: Chemical | ChemComp-ADP / #6: Chemical | ChemComp-MG / #7: Chemical | ChemComp-PO4 / | #8: Water | ChemComp-HOH / | |
|---|
-Experimental details
-Experiment
| Experiment | Method: X-RAY DIFFRACTION / Number of used crystals: 1 |
|---|
-
Sample preparation
| Crystal | Density Matthews: 2.65 Å3/Da / Density % sol: 53.62 % |
|---|---|
| Crystal grow | Temperature: 294 K / Method: vapor diffusion, sitting drop / pH: 7.5 Details: 23% (w/v) polyethylene glycol (PEG) 4000, 300 mM magnesium formate and 100 mM Tris-HCl, pH 7.5 |
-Data collection
| Diffraction | Mean temperature: 100 K | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Diffraction source | Source: SYNCHROTRON / Site: Diamond / Beamline: I04 / Wavelength: 1 Å | ||||||||||||||||||||||||||||||
| Detector | Type: DECTRIS PILATUS 6M-F / Detector: PIXEL / Date: Feb 22, 2014 | ||||||||||||||||||||||||||||||
| Radiation | Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray | ||||||||||||||||||||||||||||||
| Radiation wavelength | Wavelength: 1 Å / Relative weight: 1 | ||||||||||||||||||||||||||||||
| Reflection | Resolution: 4→47 Å / Num. obs: 35040 / % possible obs: 99 % / Redundancy: 4.3 % / CC1/2: 0.994 / Rmerge(I) obs: 0.125 / Rpim(I) all: 0.067 / Rrim(I) all: 0.142 / Net I/σ(I): 7 / Num. measured all: 149931 / Scaling rejects: 68 | ||||||||||||||||||||||||||||||
| Reflection shell | Diffraction-ID: 1
|
-Phasing
| Phasing | Method: molecular replacement |
|---|
-
Processing
| Software |
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Refinement | Method to determine structure: MOLECULAR REPLACEMENTStarting model: 5HKK Resolution: 4→45.59 Å / Cor.coef. Fo:Fc: 0.86 / Cor.coef. Fo:Fc free: 0.841 / SU B: 103.841 / SU ML: 1.322 / Cross valid method: THROUGHOUT / σ(F): 0 / ESU R Free: 1.264 / Stereochemistry target values: MAXIMUM LIKELIHOOD Details: HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Solvent computation | Ion probe radii: 0.8 Å / Shrinkage radii: 0.8 Å / VDW probe radii: 1.2 Å / Solvent model: MASK | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Displacement parameters | Biso max: 287.97 Å2 / Biso mean: 161.472 Å2 / Biso min: 75.88 Å2
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement step | Cycle: final / Resolution: 4→45.59 Å
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refine LS restraints |
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refine LS restraints NCS | Refine-ID: X-RAY DIFFRACTION / Type: interatomic distance / Weight position: 0.05
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| LS refinement shell | Resolution: 4→4.104 Å / Rfactor Rfree error: 0 / Total num. of bins used: 20
|
Movie
Controller
About Yorodumi




Mycolicibacterium smegmatis MC2 155 (bacteria)
X-RAY DIFFRACTION
United Kingdom, 4items
Citation










PDBj



