[English] 日本語
Yorodumi
- PDB-5nfi: The fimbrial anchor protein Mfa2 from Porphyromonas gingivalis -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 5nfi
TitleThe fimbrial anchor protein Mfa2 from Porphyromonas gingivalis
ComponentsMinor fimbrium anchoring subunit Mfa2
KeywordsCELL ADHESION / FIMBRIA / ADHESIN / PERIODONTITIS
Function / homology
Function and homology information


pilus assembly / cell outer membrane
Similarity search - Function
Immunoglobulin-like - #2090 / Immunoglobulin-like - #2100 / Fimbrium subunit FimB/Mfa2/Mfa3 / Fimbrillin-A associated anchor proteins Mfa1 and Mfa2 / Prokaryotic membrane lipoprotein lipid attachment site profile. / Immunoglobulin-like / Sandwich / Mainly Beta
Similarity search - Domain/homology
IODIDE ION / Minor fimbrium anchoring subunit Mfa2
Similarity search - Component
Biological speciesPorphyromonas gingivalis (bacteria)
MethodX-RAY DIFFRACTION / SYNCHROTRON / SAD / Resolution: 2.508 Å
AuthorsHall, M. / Hasegawa, Y. / Persson, K. / Yoshimura, F.
Funding support Sweden, Japan, 2items
OrganizationGrant numberCountry
Swedish Research Council2016-05009 Sweden
Japan Society for the Promotion of Science16K11466 Japan
CitationJournal: Sci Rep / Year: 2018
Title: Structural and functional characterization of shaft, anchor, and tip proteins of the Mfa1 fimbria from the periodontal pathogen Porphyromonas gingivalis.
Authors: Hall, M. / Hasegawa, Y. / Yoshimura, F. / Persson, K.
History
DepositionMar 14, 2017Deposition site: PDBE / Processing site: PDBE
Revision 1.0Feb 7, 2018Provider: repository / Type: Initial release
Revision 2.0Nov 20, 2024Group: Atomic model / Data collection ...Atomic model / Data collection / Database references / Structure summary
Category: atom_site / chem_comp_atom ...atom_site / chem_comp_atom / chem_comp_bond / database_2 / pdbx_entry_details / pdbx_modification_feature
Item: _atom_site.occupancy / _database_2.pdbx_DOI / _database_2.pdbx_database_accession

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
B: Minor fimbrium anchoring subunit Mfa2
hetero molecules


Theoretical massNumber of molelcules
Total (without water)32,2073
Polymers31,9531
Non-polymers2542
Water48627
1


  • Idetical with deposited unit
  • defined by software
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area310 Å2
ΔGint-1 kcal/mol
Surface area13260 Å2
MethodPISA
Unit cell
Length a, b, c (Å)101.600, 83.210, 38.740
Angle α, β, γ (deg.)90.000, 94.760, 90.000
Int Tables number5
Space group name H-MC121
Components on special symmetry positions
IDModelComponents
11B-516-

HOH

-
Components

#1: Protein Minor fimbrium anchoring subunit Mfa2 / Minor fimbrial antigen 2


Mass: 31953.322 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Details: MKHHHHHHPMSDYDIPTTENLYFQGAMDKMIYDNYDDCPRGVYVNFYS QTECAENPSYPAEVARLNVYAFDKDGILRSANVFEDVQLSAAKEWLIPLEKDGLYTIFAW GNIDDHYNIGEIKIGETTKQQVLMRLKQDGKWATNIDGTTLWYATSPVVELKNMEDGADQ ...Details: MKHHHHHHPMSDYDIPTTENLYFQGAMDKMIYDNYDDCPRGVYVNFYS QTECAENPSYPAEVARLNVYAFDKDGILRSANVFEDVQLSAAKEWLIPLEKDGLYTIFAW GNIDDHYNIGEIKIGETTKQQVLMRLKQDGKWATNIDGTTLWYATSPVVELKNMEDGADQ YIHTRANLREYTNRVTVSVDSLPHPENYEIKLASSNGSYRFDGTVAKADSTYYPGETKVV GDSTCRAFFTTLKLESGHENTLSVTHKPTGREIFRTDLVGAILSGQYAQNINLRCINDFDIRLVAHHCNC PDDTYVVVQIWINGWLIHSYEIEL
Source: (gene. exp.) Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561) (bacteria)
Strain: ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561
Gene: mfa2, PGN_0288 / Production host: Escherichia coli BL21(DE3) (bacteria) / References: UniProt: B2RHG2
#2: Chemical ChemComp-IOD / IODIDE ION


Mass: 126.904 Da / Num. of mol.: 2 / Source method: obtained synthetically / Formula: I
#3: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 27 / Source method: isolated from a natural source / Formula: H2O
Has protein modificationY

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 2.55 Å3/Da / Density % sol: 51.83 %
Crystal growTemperature: 293 K / Method: vapor diffusion, sitting drop / pH: 7
Details: 0.1 M Bis-Tris propane pH 7.0, 20%, PEG 3350 and 0.2 M sodium iodide

-
Data collection

DiffractionMean temperature: 100 K
Diffraction sourceSource: SYNCHROTRON / Site: ESRF / Beamline: ID29 / Wavelength: 0.97239 Å
DetectorType: DECTRIS PILATUS 6M / Detector: PIXEL / Date: Feb 23, 2015
RadiationProtocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 0.97239 Å / Relative weight: 1
ReflectionResolution: 2.508→41.605 Å / Num. obs: 11043 / % possible obs: 99.6 % / Redundancy: 12.7 % / Biso Wilson estimate: 53.28 Å2 / CC1/2: 0.998 / Rmerge(I) obs: 0.13 / Rpim(I) all: 0.033 / Net I/σ(I): 14.7
Reflection shellResolution: 2.508→2.61 Å / Redundancy: 4.9 % / Rmerge(I) obs: 0.832 / Mean I/σ(I) obs: 1.7 / Num. unique obs: 1236 / CC1/2: 0.664 / Rpim(I) all: 0.408 / % possible all: 99.1

-
Processing

Software
NameVersionClassification
PHENIX1.9_1692refinement
Aimlessdata scaling
PDB_EXTRACT3.22data extraction
XDSdata reduction
CRANK2phasing
RefinementMethod to determine structure: SAD / Resolution: 2.508→41.605 Å / SU ML: 0.39 / Cross valid method: FREE R-VALUE / σ(F): 1.36 / Phase error: 33.78
RfactorNum. reflection% reflection
Rfree0.2626 529 4.79 %
Rwork0.1966 --
obs0.1997 11041 99.59 %
Solvent computationShrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å
Displacement parametersBiso max: 134.58 Å2 / Biso mean: 64.241 Å2 / Biso min: 35.33 Å2
Refinement stepCycle: final / Resolution: 2.508→41.605 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms2213 0 2 27 2242
Biso mean--56.31 53.42 -
Num. residues----277
Refine LS restraints
Refine-IDTypeDev idealNumber
X-RAY DIFFRACTIONf_bond_d0.0082267
X-RAY DIFFRACTIONf_angle_d1.2183084
X-RAY DIFFRACTIONf_chiral_restr0.045342
X-RAY DIFFRACTIONf_plane_restr0.005398
X-RAY DIFFRACTIONf_dihedral_angle_d14.85811
LS refinement shell

Refine-ID: X-RAY DIFFRACTION / Total num. of bins used: 4

Resolution (Å)Rfactor RfreeNum. reflection RfreeRfactor RworkNum. reflection RworkNum. reflection all% reflection obs (%)
2.5081-2.76040.35351210.30252598271999
2.7604-3.15980.3281280.243426192747100
3.1598-3.98050.27031450.194526192764100
3.9805-41.61070.22641350.165626762811100
Refinement TLS params.

Method: refined / Refine-ID: X-RAY DIFFRACTION

IDL112)L122)L132)L222)L232)L332)S11 (Å °)S12 (Å °)S13 (Å °)S21 (Å °)S22 (Å °)S23 (Å °)S31 (Å °)S32 (Å °)S33 (Å °)T112)T122)T132)T222)T232)T332)Origin x (Å)Origin y (Å)Origin z (Å)
11.4172-0.21540.23843.35391.5381.95880.0156-0.19690.21380.11220.0959-0.2613-0.2138-0.0049-0.13590.5955-0.02520.02620.5603-0.00780.540635.415834.599310.324
22.88430.35550.11653.81170.8221.50510.1115-0.19-0.32030.27440.1461-0.42770.17430.0006-0.2770.4675-0.0086-0.00140.54070.0240.451939.32137.1534.6438
Refinement TLS group
IDRefine-IDRefine TLS-IDSelection detailsAuth asym-IDAuth seq-ID
1X-RAY DIFFRACTION1(chain B and resid 40:222)B40 - 222
2X-RAY DIFFRACTION2(chain B and resid 223:320)B223 - 320

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more