[English] 日本語
Yorodumi
- PDB-2qqh: Structure of C8a-MACPF reveals mechanism of membrane attack in co... -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 2qqh
TitleStructure of C8a-MACPF reveals mechanism of membrane attack in complement immune defense
ComponentsComplement component C8 alpha chain
KeywordsIMMUNE SYSTEM / MEMBRANE PROTEIN / MACPF / MEMBRANE PERFORATION / Cleavage on pair of basic residues / Complement alternate pathway / Complement pathway / Cytolysis / EGF-like domain / Glycoprotein / Immune response / Innate immunity / Membrane attack complex / Polymorphism / Secreted
Function / homology
Function and homology information


Terminal pathway of complement / membrane attack complex / complement binding / complement activation / complement activation, alternative pathway / complement activation, classical pathway / Regulation of Complement cascade / positive regulation of immune response / killing of cells of another organism / blood microparticle ...Terminal pathway of complement / membrane attack complex / complement binding / complement activation / complement activation, alternative pathway / complement activation, classical pathway / Regulation of Complement cascade / positive regulation of immune response / killing of cells of another organism / blood microparticle / immune response / protein-containing complex binding / extracellular space / extracellular exosome / extracellular region / membrane / plasma membrane
Similarity search - Function
: / Complement components C8A/B/C6, EGF-like domain / Membrane attack complex component/perforin/complement C9 / Membrane attack complex component/perforin domain, conserved site / Membrane attack complex/perforin (MACPF) domain signature. / membrane-attack complex / perforin / MAC/Perforin domain / Membrane attack complex/perforin (MACPF) domain profile. / Membrane attack complex component/perforin (MACPF) domain / Thrombospondin type 1 domain ...: / Complement components C8A/B/C6, EGF-like domain / Membrane attack complex component/perforin/complement C9 / Membrane attack complex component/perforin domain, conserved site / Membrane attack complex/perforin (MACPF) domain signature. / membrane-attack complex / perforin / MAC/Perforin domain / Membrane attack complex/perforin (MACPF) domain profile. / Membrane attack complex component/perforin (MACPF) domain / Thrombospondin type 1 domain / Thrombospondin type-1 (TSP1) repeat superfamily / Thrombospondin type-1 (TSP1) repeat profile. / Thrombospondin type 1 repeats / Thrombospondin type-1 (TSP1) repeat / Low-density lipoprotein receptor domain class A / Low-density lipoprotein (LDL) receptor class A, conserved site / LDL-receptor class A (LDLRA) domain signature. / LDL-receptor class A (LDLRA) domain profile. / Low-density lipoprotein receptor domain class A / Low-density lipoprotein (LDL) receptor class A repeat / LDL receptor-like superfamily / Growth factor receptor cysteine-rich domain superfamily / EGF-like domain signature 1.
Similarity search - Domain/homology
NICKEL (II) ION / Complement component C8 alpha chain
Similarity search - Component
Biological speciesHomo sapiens (human)
MethodX-RAY DIFFRACTION / SYNCHROTRON / SIRAS, MAD / Resolution: 2.5 Å
AuthorsHadders, M.A. / Gros, P.
CitationJournal: Science / Year: 2007
Title: Structure of C8alpha-MACPF reveals mechanism of membrane attack in complement immune defense.
Authors: Hadders, M.A. / Beringer, D.X. / Gros, P.
History
DepositionJul 26, 2007Deposition site: RCSB / Processing site: RCSB
Revision 1.0Sep 25, 2007Provider: repository / Type: Initial release
Revision 1.1Jul 13, 2011Group: Version format compliance
Revision 1.2Aug 2, 2017Group: Source and taxonomy / Category: entity_src_gen
Revision 1.3Oct 20, 2021Group: Database references / Derived calculations
Category: database_2 / pdbx_struct_conn_angle ...database_2 / pdbx_struct_conn_angle / struct_conn / struct_ref_seq_dif / struct_site
Item: _database_2.pdbx_DOI / _database_2.pdbx_database_accession ..._database_2.pdbx_DOI / _database_2.pdbx_database_accession / _pdbx_struct_conn_angle.ptnr1_auth_seq_id / _pdbx_struct_conn_angle.ptnr3_auth_seq_id / _pdbx_struct_conn_angle.value / _struct_conn.pdbx_dist_value / _struct_conn.ptnr2_auth_seq_id / _struct_ref_seq_dif.details / _struct_site.pdbx_auth_asym_id / _struct_site.pdbx_auth_comp_id / _struct_site.pdbx_auth_seq_id
Revision 1.4Nov 20, 2024Group: Data collection / Structure summary
Category: chem_comp_atom / chem_comp_bond ...chem_comp_atom / chem_comp_bond / pdbx_entry_details / pdbx_modification_feature
Remark 999Sequence Residues 337 to 379 are identical to those of residues 367 to 409 in UniProt entry P07357, ...Sequence Residues 337 to 379 are identical to those of residues 367 to 409 in UniProt entry P07357, which are ITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTER. However, only 12 residues were observed and the alignment between sequence and coordinates is unknown in this region. These 12 residues were originally modeled as ALA/GLY and have been changed to UNK during processing.

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: Complement component C8 alpha chain
hetero molecules


Theoretical massNumber of molelcules
Total (without water)37,8905
Polymers37,5431
Non-polymers3474
Water79344
1


  • Idetical with deposited unit
  • defined by author&software
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
MethodPISA
Unit cell
Length a, b, c (Å)178.920, 178.920, 75.009
Angle α, β, γ (deg.)90.00, 90.00, 90.00
Int Tables number97
Space group name H-MI422
Components on special symmetry positions
IDModelComponents
11A-525-

HOH

-
Components

#1: Protein Complement component C8 alpha chain / Complement component 8 subunit alpha


Mass: 37543.215 Da / Num. of mol.: 1 / Mutation: C164S
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Gene: C8A / Plasmid: pET / Production host: Escherichia coli (E. coli) / Strain (production host): Origami / References: UniProt: P07357
#2: Chemical ChemComp-SO4 / SULFATE ION


Mass: 96.063 Da / Num. of mol.: 3 / Source method: obtained synthetically / Formula: SO4
#3: Chemical ChemComp-NI / NICKEL (II) ION


Mass: 58.693 Da / Num. of mol.: 1 / Source method: obtained synthetically / Formula: Ni
#4: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 44 / Source method: isolated from a natural source / Formula: H2O
Has protein modificationY

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 3.98 Å3/Da / Density % sol: 69.08 %
Crystal growTemperature: 303 K / Method: vapor diffusion, sitting drop / pH: 8
Details: 1M LiSO4, 5mM NiCl2, 100mM Tris, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 303K

-
Data collection

DiffractionMean temperature: 100 K
Diffraction sourceSource: SYNCHROTRON / Site: ESRF / Beamline: ID29 / Wavelength: 1.006 Å
DetectorType: ADSC QUANTUM 315 / Detector: CCD / Date: Mar 10, 2007
RadiationMonochromator: Si 311 Channel / Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 1.006 Å / Relative weight: 1
ReflectionResolution: 2.5→40 Å / Num. all: 21349 / Num. obs: 21349 / % possible obs: 100 % / Observed criterion σ(F): 1 / Observed criterion σ(I): 1 / Redundancy: 7.1 % / Biso Wilson estimate: 63.3 Å2 / Rmerge(I) obs: 0.08 / Rsym value: 0.08 / Net I/σ(I): 17.3
Reflection shellResolution: 2.5→2.64 Å / Redundancy: 7.1 % / Rmerge(I) obs: 0.513 / Mean I/σ(I) obs: 3.2 / Num. unique all: 2888 / Rsym value: 0.513 / % possible all: 100

-
Processing

Software
NameVersionClassification
REFMAC5.3.0008refinement
ADSCQuantumdata collection
MOSFLMdata reduction
SCALAdata scaling
SOLVEphasing
RefinementMethod to determine structure: SIRAS, MAD / Resolution: 2.5→40 Å / Cor.coef. Fo:Fc: 0.903 / Cor.coef. Fo:Fc free: 0.888 / SU B: 16.508 / SU ML: 0.198 / Isotropic thermal model: isotropic / Cross valid method: THROUGHOUT / ESU R: 0.315 / ESU R Free: 0.255 / Stereochemistry target values: MAXIMUM LIKELIHOOD / Details: HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
RfactorNum. reflection% reflectionSelection details
Rfree0.28725 1089 5.1 %RANDOM
Rwork0.25475 ---
all0.25644 20253 --
obs0.25644 20253 99.98 %-
Solvent computationIon probe radii: 0.8 Å / Shrinkage radii: 0.8 Å / VDW probe radii: 1.4 Å / Solvent model: BABINET MODEL WITH MASK
Displacement parametersBiso mean: 53.487 Å2
Baniso -1Baniso -2Baniso -3
1--0.69 Å20 Å20 Å2
2---0.69 Å20 Å2
3---1.38 Å2
Refinement stepCycle: LAST / Resolution: 2.5→40 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms2402 0 16 44 2462
Refine LS restraints
Refine-IDTypeDev idealDev ideal targetNumber
X-RAY DIFFRACTIONr_bond_refined_d0.0320.0222461
X-RAY DIFFRACTIONr_angle_refined_deg1.7031.9633315
X-RAY DIFFRACTIONr_dihedral_angle_1_deg8.5015299
X-RAY DIFFRACTIONr_dihedral_angle_2_deg36.7824.202119
X-RAY DIFFRACTIONr_dihedral_angle_3_deg18.81915423
X-RAY DIFFRACTIONr_dihedral_angle_4_deg22.491514
X-RAY DIFFRACTIONr_chiral_restr0.1250.2348
X-RAY DIFFRACTIONr_gen_planes_refined0.0110.021866
X-RAY DIFFRACTIONr_nbd_refined0.2520.21102
X-RAY DIFFRACTIONr_nbtor_refined0.310.21634
X-RAY DIFFRACTIONr_xyhbond_nbd_refined0.1490.2114
X-RAY DIFFRACTIONr_symmetry_vdw_refined0.2350.253
X-RAY DIFFRACTIONr_symmetry_hbond_refined0.1720.210
X-RAY DIFFRACTIONr_mcbond_it0.6951.51548
X-RAY DIFFRACTIONr_mcangle_it1.16522388
X-RAY DIFFRACTIONr_scbond_it1.62131060
X-RAY DIFFRACTIONr_scangle_it2.4054.5927
LS refinement shellResolution: 2.5→2.64 Å / Total num. of bins used: 20
RfactorNum. reflection% reflection
Rfree0.308 151 -
Rwork0.328 1464 -
obs-2888 100 %

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more