| PDBID: | 9c73 | | Status: | PROC -- to be processed | | Title: | Hybrid G-quadruplex from Tetrahymena thermophila telomeric sequence in complex with TrisQO | | Authors: | Ali, A., Yatsunyk, L.A. | | Deposition date: | 2024-06-10 |
|
| PDBID: | 9fkk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of glycosynthase IXT6 (E241G mutant), the intracellular xylanase of G.proteiniphilus T-6 in complex with xylobiose-F and xylotetraose-F molecules | | Authors: | Hadad, N., Chmelnik, O., Dessau, M., Shoham, Y., Shoham, G. | | Deposition date: | 2024-06-03 | | Release date: | 2025-06-03 |
|
| PDBID: | 9fk3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of glycosynthase XT6 (E265G mutant), the extracellular xylanase of G.proteiniphilus T-6 in complex with xylobiose-F and xylotetraose-F molecules | | Authors: | Hadad, N., Chmelnik, O., Dessau, M., Shoham, Y., Shoham, G. | | Deposition date: | 2024-06-01 | | Release date: | 2025-06-01 |
|
| PDBID: | 9fjz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Teth514_1788 1,2-beta-oligomannan phosphorylase in complex with mannopentaose | | Authors: | Cioci, G., Ladeveze, S., Durand, J., Potocki-Veronese, G. | | Deposition date: | 2024-05-31 |
|
| PDBID: | 9fj8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Teth514_1788 1,2-beta-oligomannan phosphorylase in complex with mannotetraose | | Authors: | Cioci, G., Durand, J., Potocki-Veronese, G., Ladeveze, S. | | Deposition date: | 2024-05-30 |
|
| PDBID: | 8zow | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Metyltetraprole-bound porcine bc1 complex | | Authors: | Wang, Y.X., Sun, J.Y., Cui, G.R., Yang, G.F. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8zok | | Status: | HPUB -- hold until publication | | Title: | EcGPR tetramer with catalytic intermediates | | Authors: | Zhang, T., Leng, Q., Liu, L.J. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 8zmt | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in Metyltetraprole-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9fdd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of full length tetramer CysB from Klebsiella aerogenes in complex with N-acetylserine | | Authors: | Verschueren, K.H.G., Dodson, E.J., Wilkinson, A.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bqr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray Structure of a Second-Sphere H-bond Deletion Mutant of a De Novo Designed Self Assembled Peptide Tetramer Featuring a Cu(His)4(H2O) Coordination Motif | | Authors: | Chakraborty, S., Sony, S., Prakash, D., Andi, B. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9bpb | | Status: | HPUB -- hold until publication | | Title: | Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae | | Authors: | Eldeeb, M.H., Carlstrom, A., Berndtsson, J., Ott, M., Fontanesi, F. | | Deposition date: | 2024-05-07 |
|
| PDBID: | 9bow | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Thermus thermophilus serine hydroxymethyltransferase with PLP-L-Ser external aldimine and 5-formyltetrahydrofolate (folinic acid) | | Authors: | Drago, V.N., Kovalevsky, A. | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9box | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of human mitochondrial serine hydroxymethyltransferase (hSHMT2) with PLP-glycine external aldimine and 5-formyltetrahydrofolate (folinic acid) | | Authors: | Drago, V.N., Kovalevsky, A. | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9boh | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of Thermus Thermophilus serine hydroxymethyltransferase (SHMT) with PLP-glycine external aldimine and 5-formyltetrahydrofolate (folinic acid) | | Authors: | Drago, V.N., Kovalevsky, A. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bhw | | Status: | HOLD -- hold until a certain date | | Title: | Septin Tetrameric Complex SEPT7/SEPT9 of Ciona intestinalis by Cryo-EM | | Authors: | Mendonca, D.C., Pereira, H.M., Garratt, R.C. | | Deposition date: | 2024-04-22 | | Release date: | 2025-04-22 |
|
| PDBID: | 9bhg | | Status: | HPUB -- hold until publication | | Title: | PRMT1-Tetramer | | Authors: | Nadendla, E.K., Wang, C.H. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z2z | | Status: | HPUB -- hold until publication | | Title: | PRMT1-Tetramer | | Authors: | Nadendla, E.K., Wang, C.H., Ho, M.C. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z0r | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of tetramer HtmB2-CT | | Authors: | Sun, Y.H., Zhang, Z.Y., Mei, Q. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 9b7y | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of TetR regulator Mce3R from Mycobacterium tuberculosis bound to a DNA oligonucleotide | | Authors: | Panagoda, N., Sampson, N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yu7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CXCR4 tetramer | | Authors: | Liu, A., Liu, Y. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9b3s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of casein kinase 1 delta 1 with tethered phosphorylated tail | | Authors: | Harold, R.L., Yaitanes, N., Tripathi, S.T., Partch, C.L. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8yqf | | Status: | HPUB -- hold until publication | | Title: | Structure of PsSIR2 tetradecamer | | Authors: | Yu, G., Liao, F., Li, X., Li, Z., Zhang, H. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8ypp | | Status: | HPUB -- hold until publication | | Title: | Structure of the tetrameric trans-autophosphorylation complex of Tribolium castaneum (Tc) PINK1 | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Liu, Z., Mi, L.Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9b2y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Kynurenine monooxygenase from Pseudomonas fluorescens complexed with 4-chlorophenylacetyltetrazole | | Authors: | Phillips, R.S., Ma, W. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9b2h | | Status: | HPUB -- hold until publication | | Title: | HIV-1 wild type protease with GRL-072-17A, a substituted tetrahydrofuran derivative based on Darunavir as P2 group | | Authors: | Wang, Y.-F., Agniswamy, J., Ghosh, A.K., Weber, I.T. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
