PDBID: | 9c9p | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cas9 ternary complex, 14-nt sgRNA, State I (linear) | Authors: | Kiernan, K.A., Simonovic, M. | Deposition date: | 2024-06-14 |
|
PDBID: | 9bz2 | Status: | HPUB -- hold until publication | Title: | Class 14 model for turnover condition of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-24 |
|
PDBID: | 9bxb | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH DL-III-14 | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | Deposition date: | 2024-05-22 |
|
PDBID: | 9bjp | Status: | HPUB -- hold until publication | Title: | CTX-M-14 WT in complex with BLIP E73W | Authors: | Lu, S., Rivera, P., Sankaran, B., Prasad, B.V.V., Palzkill, T.G. | Deposition date: | 2024-04-25 |
|
PDBID: | 9f35 | Status: | HPUB -- hold until publication | Title: | Co-crystal structure of 14-3-3sigma in complex with B-Raf pS365 phosphopeptide | Authors: | Wu, Q. | Deposition date: | 2024-04-24 |
|
PDBID: | 9f1j | Status: | AUTH -- processed, waiting for author review and approval | Title: | First bromodomain of BRD4 in complex with ISOX-DUAL based degrader 14 | Authors: | Balourdas, D.I., Edmonds, A.K., Marsh, G.P., Maple, H.J., Spencer, J., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | Deposition date: | 2024-04-19 |
|
PDBID: | 9exi | Status: | AUTH -- processed, waiting for author review and approval | Title: | Coxsackievirus A9 bound with compound 14 (CL275) | Authors: | Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C. | Deposition date: | 2024-04-08 |
|
PDBID: | 9bat | Status: | HPUB -- hold until publication | Title: | Crystal structure of sterol 14 alpha-demethylase (CYP51) from deep-sea fish Coryphaenoides armatus (abyssal grenadier) in the ligand-free state | Authors: | Hargrove, T.Y., Wawrzak, Z., Minasov, G., Lepesheva, G.I. | Deposition date: | 2024-04-04 |
|
PDBID: | 9ew1 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, CRAF phosphopeptide (pS259) and compound 79 (1124379). | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ew4 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide 12mer (pS259) and compound 86 (1124384) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ew5 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) 12mer and compound 23 (1083848) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ew7 | Status: | HPUB -- hold until publication | Title: | Binary structure of 14-3-3s and CRAF phosphopeptide (pS259) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ew6 | Status: | HPUB -- hold until publication | Title: | Binary structure of 14-3-3s and BRAF phosphopeptide (pS365) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ew3 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide 12-mer (pS259) and compound 78 (1084378) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yue | Status: | HPUB -- hold until publication | Title: | Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster | Authors: | Wei, Y., Jobichen, C., Imasaki, T., Nitta, R., Wang, M.Y., Sivaraman, J., Endow, S.A. | Deposition date: | 2024-03-27 |
|
PDBID: | 9esz | Status: | HPUB -- hold until publication | Title: | CDK2-cyclin A in complex with FragLite 14 | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | Deposition date: | 2024-03-26 | Sequence: | >Entity 1 GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
>Entity 2 GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
|
|
PDBID: | 8s42 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 80 (1124898) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-02-21 |
|
PDBID: | 8s2q | Status: | HPUB -- hold until publication | Title: | MSOX movie series dataset 2 (1.14 MGy) for as isolated BrJNiR (Cu containing nitrite reductase (NirK) from Bradyrhizobium japonicum USDA110) at pH 8. | Authors: | Rose, S.L., Ferroni, F.M., Horrell, S., Brondino, C.D., Eady, R.R., Jaho, S., Hough, M.A., Owen, A.L., Antonyuk, S.V., Hasnain, S.S. | Deposition date: | 2024-02-18 |
|
PDBID: | 8rs1 | Status: | HPUB -- hold until publication | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (125 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8vso | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3 sigma, BRAF phosphopeptide (pS365) and compound 78 (1124378) | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-01-24 |
|
PDBID: | 8vsl | Status: | HPUB -- hold until publication | Title: | Binary structure of 14-3-3 sigma and ARAF phosphopeptide (pS214) | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-01-24 |
|
PDBID: | 8vsm | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3 sigma, ARAF phosphopeptide (pS214) and compound 78 (1124378) | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-01-24 |
|
PDBID: | 8vsn | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3 sigma, ARAF phosphopeptide (pS214) and compound 79 (1124379) | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rky | Status: | HPUB -- hold until publication | Title: | X-ray structure of the drug binding domain of AlbA in complex with the KMR-14-14 compound of the pyrrolobenzodiazepines class | Authors: | Di Palma, M., Surani, Y.M., Rahman, K.M., Steiner, R.A. | Deposition date: | 2024-01-01 |
|
PDBID: | 8xke | Status: | HPUB -- hold until publication | Title: | The structure of HLA-A/14-3-D | Authors: | Zhang, J.N., Yue, C., Liu, J., Sun, Z.Y. | Deposition date: | 2023-12-23 |
|