Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9p4g
Status:HOLD -- hold until a certain date
Title:Crystal Structure of Flagellar Assembly Protein FliW from Campylobacter jejuni subsp. jejuni 81-176-DRH212
Authors:Minasov, G., Shuvalova, L., Wawrzak, Z., Kiryukhina, O., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID)
Deposition date:2025-06-16
Release date:2026-06-16
PDBID:9p1q
Status:HPUB -- hold until publication
Title:Crystal structure of Ube2E3
Authors:Cook, M.W., Brzovic, P.S., Stenkamp, R.E.
Deposition date:2025-06-10
Sequence:

>Entity 1


MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
PDBID:9p13
Status:AUTH -- processed, waiting for author review and approval
Title:Lysozyme in situ room temperature on site
Authors:Snell, M.E., Campomizzi, C.S., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J.
Deposition date:2025-06-09
PDBID:9p16
Status:AUTH -- processed, waiting for author review and approval
Title:Thermolysin Room-Temperature In-Situ
Authors:Campomizzi, C.S., Snell, M.E., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J.
Deposition date:2025-06-09
PDBID:9p17
Status:HPUB -- hold until publication
Title:Thermolysin Room-Temperature In-Situ
Authors:Campomizzi, C.S., Snell, M.E., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J.
Deposition date:2025-06-09
PDBID:9vd1
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of Dimeric Suv3-ssRNA-AMPPNP complex
Authors:Patra, M., Yuan, H.S.
Deposition date:2025-06-07
PDBID:9vd0
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of monomeric Suv3-ssRNA-AMPPNP complex
Authors:Patra, M., Yuan, H.S.
Deposition date:2025-06-07
PDBID:7ifn
Status:PROC -- to be processed
Title:Endothiapepsin crystal A02a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ifo
Status:PROC -- to be processed
Title:Endothiapepsin crystal A03a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ifp
Status:PROC -- to be processed
Title:Endothiapepsin crystal A04a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ifq
Status:PROC -- to be processed
Title:Endothiapepsin crystal A05a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ifr
Status:PROC -- to be processed
Title:Endothiapepsin crystal A06a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ifs
Status:PROC -- to be processed
Title:Endothiapepsin crystal A08a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ift
Status:PROC -- to be processed
Title:Endothiapepsin crystal A09a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ifu
Status:PROC -- to be processed
Title:Endothiapepsin crystal A10a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ifv
Status:PROC -- to be processed
Title:Endothiapepsin crystal A12a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ifw
Status:PROC -- to be processed
Title:Endothiapepsin crystal Apo01 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ifx
Status:PROC -- to be processed
Title:Endothiapepsin crystal Apo02 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ify
Status:PROC -- to be processed
Title:Endothiapepsin crystal Apo03 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ifz
Status:PROC -- to be processed
Title:Endothiapepsin crystal Apo04 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ig0
Status:PROC -- to be processed
Title:Endothiapepsin crystal Apo05 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ig1
Status:PROC -- to be processed
Title:Endothiapepsin crystal Apo06 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ig2
Status:PROC -- to be processed
Title:Endothiapepsin crystal Apo07 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ig3
Status:PROC -- to be processed
Title:Endothiapepsin crystal Apo08 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05
PDBID:7ig4
Status:PROC -- to be processed
Title:Endothiapepsin crystal Apo09 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation
Authors:Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S.
Deposition date:2025-06-05

237992

數據於2025-06-25公開中

PDB statisticsPDBj update infoContact PDBjnumon