PDBID: | 8znl | Status: | AUTH -- processed, waiting for author review and approval | Title: | PD-L1 de novo designed binder with picomolar binding affinity | Authors: | Zhao, L. | Deposition date: | 2024-05-27 |
|
PDBID: | 9bqr | Status: | AUTH -- processed, waiting for author review and approval | Title: | X-ray Structure of a Second-Sphere H-bond Deletion Mutant of a De Novo Designed Self Assembled Peptide Tetramer Featuring a Cu(His)4(H2O) Coordination Motif | Authors: | Chakraborty, S., Sony, S., Prakash, D., Andi, B. | Deposition date: | 2024-05-10 |
|
PDBID: | 8yl4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the de novo designed protein ZZ01 in the crystal form 1 | Authors: | Zhao, Z., Hattori, M. | Deposition date: | 2024-03-05 |
|
PDBID: | 8yl8 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the de novo designed protein ZZ01 in the crystal form 2 | Authors: | Zhao, Z., Hattori, M. | Deposition date: | 2024-03-05 |
|
PDBID: | 8xyw | Status: | HPUB -- hold until publication | Title: | De novo designed protein Trx-3 | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyv | Status: | HPUB -- hold until publication | Title: | De novo designed protein 0705-5 | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyr | Status: | HPUB -- hold until publication | Title: | De novo designed protein GPX4-2 | Authors: | Liu, L.J., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xys | Status: | HPUB -- hold until publication | Title: | De novo designed protein GPX4-1 | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyt | Status: | HPUB -- hold until publication | Title: | De novo designed protein GPX4-4 | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyu | Status: | HPUB -- hold until publication | Title: | De novo designed protein GPX4-3 | Authors: | Guo, Z., Liu, J.L., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8vhs | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | X-ray Structure of a De Novo Designed Self Assembled Peptide Tetramer Featuring a Cu(His)4(H2O) Coordination Motif | Authors: | Chakraborty, S., Mitra, S., Prakash, D., Prasad, P. | Deposition date: | 2024-01-02 |
|
PDBID: | 8v94 | Status: | HPUB -- hold until publication | Title: | De novo designed homo-oligomeric TM domain aITL_04927 | Authors: | Mravic, M., Anderson, C.T. | Deposition date: | 2023-12-07 |
|
PDBID: | 8wx8 | Status: | HPUB -- hold until publication | Title: | De novo design protein -T09 | Authors: | Wang, C., Wang, S., Liu, Y. | Deposition date: | 2023-10-27 |
|
PDBID: | 8wwc | Status: | HPUB -- hold until publication | Title: | De novo design binder of HRAS -120-4 | Authors: | Wang, L., Wang, S., Liu, Y. | Deposition date: | 2023-10-25 |
|
PDBID: | 8upb | Status: | HPUB -- hold until publication | Title: | De novo designed IL-6 mimetic | Authors: | Borowska, M.T., Jude, K.M., Garcia, K.C. | Deposition date: | 2023-10-22 |
|
PDBID: | 8ugw | Status: | HPUB -- hold until publication | Title: | Computational design of highly signaling active membrane receptors through de novo solvent-mediated allosteric networks | Authors: | Wang, J., Chen, K.Y., Lai, J.K., Russell, A.M., Conners, K., Rutter, M.E., Condon, B., Tung, F., Kodandapani, L., Chau, B., Zhao, X., Benach, J., Baker, K., Hembre, E.J., Barth, P. | Deposition date: | 2023-10-06 |
|
PDBID: | 8ug0 | Status: | HPUB -- hold until publication | Title: | Crystal structure of de novo designed metal-controlled heterodimer of mutant B1 immunoglobulin-binding domain of Streptococcal Protein G MCHeT_A + MCHeT_B | Authors: | Mealka, M., Maniaci, B., Stec, B., Huxford, T. | Deposition date: | 2023-10-05 |
|
PDBID: | 8ug2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of de novo designed metal-controlled heterodimer of mutant B1 immunoglobulin-binding domain of Streptococcal Protein G MCHeT_A + MCHeT_C | Authors: | Mealka, M., Maniaci, B., Stec, B., Huxford, T. | Deposition date: | 2023-10-05 |
|
PDBID: | 8wjf | Status: | HPUB -- hold until publication | Title: | Unlocking Immunogenic Potential: Innovating a Peptide/Ferritin Fusion Tag Nano-Delivery Platform from de novo design to Significantly Enhance Antigenicity of the Rabies Virus Glycoprotein Domain III | Authors: | Fu, D., Wang, M., Guo, Y. | Deposition date: | 2023-09-25 |
|
PDBID: | 8u5w | Status: | HPUB -- hold until publication | Title: | De novo designed pentameric helical bundle protein | Authors: | Bick, M.J., Xu, C., Sankaran, B., Baker, D. | Deposition date: | 2023-09-13 |
|
PDBID: | 8w97 | Status: | HPUB -- hold until publication | Title: | De novo design protein -PK16 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-09-04 |
|
PDBID: | 8ki2 | Status: | AUTH -- processed, waiting for author review and approval | Title: | De novo design protein -N9 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-22 |
|
PDBID: | 8kdq | Status: | HPUB -- hold until publication | Title: | De novo design protein -T03 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-09 |
|
PDBID: | 8kck | Status: | HPUB -- hold until publication | Title: | De novo design protein -N9 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-07 | Sequence: | >Entity 1 GAEAAAAAAVTAELRAFRAAGGTVELEDLPVTPETLARAEAALARLPPESVAVETYTVPAPTPEAFLAALEAALARLAAEGLPAILLRVVDADGNLVGSILVAAAGPPAESAAATGRVLTIYVASSPEGLKVARGLAIETRDAGGLALAIGASGAWALAGLAGALALARRLAEAHGAPVRVVTIGDPANPTDAALAAAIRAAYAAALEHHHHHH
|
|
PDBID: | 8kcj | Status: | HPUB -- hold until publication | Title: | De novo design protein -N7 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-07 |
|