| PDBID: | 9dyp | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Rubisco from Methanococcoides burtonii | | Authors: | Pereira, J.H., Liu, A.K., Shih, P.M., Adams, P.D. | | Deposition date: | 2024-10-14 |
|
| PDBID: | 9dyr | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Rubisco in complex with CABP from Methanococcoides burtonii | | Authors: | Pereira, J.H., Liu, A.K., Shih, P.M., Adams, P.D. | | Deposition date: | 2024-10-14 |
|
| PDBID: | 9h2n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of tyrosinase from Priestia megaterium F227Y mutant soaked in Cu(II) and sodium dithionite | | Authors: | Englund, A.N.B., Rohr, A.K. | | Deposition date: | 2024-10-14 |
|
| PDBID: | 9h2o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of apo-tyrosinase from Priestia megaterium | | Authors: | Englund, A.N.B., Rohr, A.K. | | Deposition date: | 2024-10-14 |
|
| PDBID: | 9h29 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of tyrosinase from Priestia megaterium F227Y mutant soaked in Cu(II) | | Authors: | Englund, A.N.B., Rohr, A.K. | | Deposition date: | 2024-10-11 |
|
| PDBID: | 9dx5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | EcRuvB T102R hexamer assembly | | Authors: | Rish, A.D., Fu, T.M. | | Deposition date: | 2024-10-10 |
|
| PDBID: | 9dx4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | EcRuvB T102R mutant | | Authors: | Rish, A.D., Fu, T.M. | | Deposition date: | 2024-10-10 |
|
| PDBID: | 9h1u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Heterooligomeric Bacterioferritin | | Authors: | Stein, D., Zalk, R., Shahar, A., Zarivach, R., Frank, G.A. | | Deposition date: | 2024-10-10 |
|
| PDBID: | 9h22 | | Status: | HPUB -- hold until publication | | Title: | Cryo EM structure of RC-dLH complex model II from Gemmatimonas groenlandica | | Authors: | Gardiner, A.T., Jing, Y., Bina, D., Mujakic, I., Gardian, Z., Kaftan, D., Joosten, M., Jakobi, A., Castro-Hartmann, P., Qian, P., Koblizek, M. | | Deposition date: | 2024-10-10 | | Release date: | 2026-04-10 |
|
| PDBID: | 9h1t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of apo-tyrosinase from Priestia megaterium F227Y mutant | | Authors: | Englund, A.N.B., Rohr, A.K. | | Deposition date: | 2024-10-10 |
|
| PDBID: | 9h0t | | Status: | HPUB -- hold until publication | | Title: | N terminal domain of BC2L-C lectin (1-131) in complex with a beta-fucosylamide side-product | | Authors: | Antonin, G., Varrot, A. | | Deposition date: | 2024-10-09 | | Release date: | 2026-04-09 | | Sequence: | >Entity 1
GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
| PDBID: | 9h0u | | Status: | HPUB -- hold until publication | | Title: | N terminal domain of BC2L-C lectin (1-131) with covalent beta-fucosylamide ligand | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-10-09 | | Release date: | 2026-04-09 | | Sequence: | >Entity 1
GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
| PDBID: | 9h0z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TTL[Nle], thermophilic lipase TTL from Thermoanaerobacter thermohydrosulfuricus containing non-canonical amino acid Nle at the position of Met | | Authors: | Hromic-Jahjefendic, A., Pavkov-Keller, T., Wiltschi, B., Gruber, K. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9h19 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of RC-dLH complex model I from Gem. groenlandica strain TET16 | | Authors: | Gardiner, A., Qian, P., Koblizek, M., Jing, Y., Joosten, M., Jakobi, A., Bina, D., Mujakic, I., Gardian, Z., Kaftan, D., Castro-Hartmann, P. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jty | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Postload capsid of phiYY, a prokaryotic dsRNA virus | | Authors: | Meng, K.W., Huyan, Y.N., Meng, G. | | Deposition date: | 2024-10-08 | | Release date: | 2026-04-08 |
|
| PDBID: | 9h0k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CREBBP histone acetyltransferase domain in complex with Propionyl- Coenzyme A | | Authors: | Mechaly, A.E., Cui, G., Green, M.R., Rodrigues-Lima, F. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9ju3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 3-fold Block-refine of Full particle of phiYY, a prokaryotic dsRNA virus | | Authors: | Meng, K.W., Cui, C.X., HuYan, Y.N., Zhang, X.Z., Meng, G. | | Deposition date: | 2024-10-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9h01 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | nsp14 of SARS-CoV-2 in complex with a camelid nanobody | | Authors: | Gauffre, P., Ferron, F., Canard, B. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9jsr | | Status: | HOLD -- hold until a certain date | | Title: | 50S precursor - Erm complex (C-I) | | Authors: | Sengupta, S., Mukherjee, R., Pilsl, M., Bagale, S., Adhikary, A.D., Borkar, A., Pradeepkumar, P.I., Engel, C., Chowdhury, A., Kaushal, P.S., Anand, R. | | Deposition date: | 2024-10-01 | | Release date: | 2026-01-01 |
|
| PDBID: | 9dse | | Status: | HPUB -- hold until publication | | Title: | Cyanide-ligated Bordetella pertussis globin coupled sensor regulatory domain | | Authors: | Hoque, N.J., Pope, S.R., Boal, A.K. | | Deposition date: | 2024-09-27 | | Release date: | 2026-03-26 |
|
| PDBID: | 9dsf | | Status: | HPUB -- hold until publication | | Title: | Cyanide-ligated Bordetella pertussis globin coupled sensor regulatory domain S68A | | Authors: | Hoque, N.J., Pope, S.R., Boal, A.K. | | Deposition date: | 2024-09-27 | | Release date: | 2026-03-26 |
|
| PDBID: | 9gw6 | | Status: | HPUB -- hold until publication | | Title: | Lys9DabMC6*a 2-Delta | | Authors: | Maglio, O., Lombardi, A., Chino, M., Pirro, F. | | Deposition date: | 2024-09-26 | | Release date: | 2026-03-26 |
|
| PDBID: | 9jns | | Status: | HOLD -- hold until a certain date | | Title: | 50S precursor - Erm complex (C-II) | | Authors: | Sengupta, S., Mukherjee, R., Pilsl, M., Bagale, S., Adhikary, A.D., Borkar, A., Pradeepkumar, P.I., Engel, C., Chowdhury, A., Kaushal, P.S., Anand, R. | | Deposition date: | 2024-09-23 | | Release date: | 2025-12-23 |
|
| PDBID: | 9jmk | | Status: | HOLD -- hold until a certain date | | Title: | 50S Ribosomal Subunit precursor state III | | Authors: | Sengupta, S., Mukherjee, R., Pilsl, M., Bagale, S., Adhikary, A.D., Borkar, A., Pradeepkumar, P.I., Engel, C., Chowdhury, A., Kaushal, P.S., Anand, R. | | Deposition date: | 2024-09-20 | | Release date: | 2025-12-20 |
|
| PDBID: | 9gu8 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to a FDA ligand 4 | | Authors: | Munoz-Reyes, D., Perez-Suarez, S., Sanchez-Barrena, M.J. | | Deposition date: | 2024-09-19 | | Release date: | 2026-03-19 |
|
