PDBID: | 9ckp | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-09 |
|
PDBID: | 9ckq | Status: | HPUB -- hold until publication | Title: | Human G protein-coupled receptor kinase 5-D311N ligand-free form | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-07-09 |
|
PDBID: | 9cko | Status: | HPUB -- hold until publication | Title: | Human G protein-coupled receptor kinase 5 wild-type in complex with sangivamycin | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-07-09 |
|
PDBID: | 9cks | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Human G protein-coupled receptor kinase 5-D311N in complex with ATP and manganese ions | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-07-09 |
|
PDBID: | 9ckr | Status: | HPUB -- hold until publication | Title: | Human G protein-coupled receptor kinase 5-D311N in complex with ATP and magnesium ion | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-07-09 |
|
PDBID: | 9ckj | Status: | AUTH -- processed, waiting for author review and approval | Title: | Co-crystal structure of 53BP1 tandem Tudor domains in complex with UNC9512 | Authors: | Zeng, H., Dong, A., Shell, D.J., Foley, C., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | Deposition date: | 2024-07-09 |
|
PDBID: | 9ckm | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-09 |
|
PDBID: | 9cki | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-09 |
|
PDBID: | 9ckn | Status: | HPUB -- hold until publication | Title: | Histidine-covalent alpha-helical peptide (compound 6) targeting hMcl-1 | Authors: | Muzzarelli, K.M., Assar, Z., Alboreggia, G., Pellecchia, M. | Deposition date: | 2024-07-09 |
|
PDBID: | 9ckt | Status: | HPUB -- hold until publication | Title: | X-ray diffraction structure of papain co-crystallized with E-64 | Authors: | Vlahakis, N.W., Rodriguez, J.A. | Deposition date: | 2024-07-09 |
|
PDBID: | 9cjw | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0e | Status: | PROC -- to be processed | Title: | CryoEM structure of PmcTnsC-dsDNA-AMPPNP in complex with PmcTnsAB hook | Authors: | Finocchio, G., Chanez, C., Querques, I., Speichert, K.J., Jinek, M. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0f | Status: | HPUB -- hold until publication | Title: | CryoEM structure of PmcTnsC-dsDNA-AMPPNP | Authors: | Finocchio, G., Chanez, C., Querques, I., Speichert, K.J., Jinek, M. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0c | Status: | HPUB -- hold until publication | Title: | Structure of human Mical1 bMERB_V978A_V985A domain:Rab10 complex. | Authors: | Rai, A., Goody, R.S. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0d | Status: | HPUB -- hold until publication | Title: | Structure of human Mical1 bMERB_V978A domain:Rab10 complex. | Authors: | Rai, A., Goody, R.S. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0m | Status: | HPUB -- hold until publication | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 288K | Authors: | Horvath, D. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0j | Status: | HPUB -- hold until publication | Title: | Structure of the PRO-PRO endopeptidase (PPEP-3) from Geobacillus thermodenitrificans | Authors: | Claushuis, B., Wojtalla, F., van Leeuwen, H., Corver, J., Baumann, U., Hensbergen, P. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0h | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0i | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0g | Status: | HPUB -- hold until publication | Title: | BsCdaA in complex with Compound 7 | Authors: | Neumann, P., Ficner, R. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0q | Status: | HPUB -- hold until publication | Title: | Xenopus laevis undecorated microtubule - 15 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0r | Status: | HPUB -- hold until publication | Title: | Xenopus laevis undecorated microtubule - 15 protofilament, 4-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0s | Status: | HPUB -- hold until publication | Title: | Xenopus tropicalis undecorated microtubule - 14 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0t | Status: | HPUB -- hold until publication | Title: | Xenopus tropicalis undecorated microtubule - 15 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0l | Status: | HPUB -- hold until publication | Title: | Crystal structure of the RING-ZnF1 fragment of SIAH1 | Authors: | Coste, F., Suskiewicz, M.J. | Deposition date: | 2024-07-08 | Sequence: | >Entity 1 MTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPLEHHHHHH
|
|