| PDBID: | 9oe4 | | Status: | HPUB -- hold until publication | | Title: | Zebrafish Abcb4 in IF-Narrow conformation in the presence of Elacridar (ELA-IF-Narrow) | | Authors: | Zhan, J., Xia, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oee | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | S. griseus TUA bound UmbA4 complexes | | Authors: | Park, Y.J., Zhao, Q., Seattle Structural Genomics Center for Infectious Disease (SSGCID), DiMaio, F., Mougous, J.D., Veesler, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oek | | Status: | HPUB -- hold until publication | | Title: | amyloid fibril of recombinant transforming growth factor beta induced protein FAS1-4 domain with V624M mutation | | Authors: | Jiang, Y.X., Sawaya, M.R., Eisenberg, D.S. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oe1 | | Status: | HPUB -- hold until publication | | Title: | Zebrafish Abcb4 in IF-narrow conformation in the presence of Tariquidar (TQR-IF-Narrow) | | Authors: | Zhan, J., Xia, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oe2 | | Status: | HPUB -- hold until publication | | Title: | Zebrafish Abcb4 in IF-medium conformation in the presence of Tariquidar (TQR-IF-Medium) | | Authors: | Zhan, J., Xia, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oe3 | | Status: | HPUB -- hold until publication | | Title: | Zebrafish Abcb4 in IF-Wide conformation in the presence of Tariquidar (TQR-IF-Wide) | | Authors: | Zhan, J., Xia, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9r1q | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Beluga whale coronavirus spike glycoprotein | | Authors: | Hulswit, R.J.G., Hurdiss, D.L. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9r1s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an NtA622L variant in complex with NADPH and Nicotinic acid N-glucoside | | Authors: | Mokos, D., Daniel, B. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9uod | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of pHBMT1 from Populus trichocarpa | | Authors: | Li, Q., Liu, Y.C., Li, T., Han, X.D. | | Deposition date: | 2025-04-25 | | Release date: | 2026-04-25 |
|
| PDBID: | 9od9 | | Status: | HPUB -- hold until publication | | Title: | Structure of disulfide-stabilized IL-18 variant | | Authors: | Sun, D., Masureel, M., Bainbridge, T., Bulutoglu, B. | | Deposition date: | 2025-04-25 |
|
| PDBID: | 9unt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of UPF0235 protein PF1765 from Pyrococcus furiosus | | Authors: | Yadav, B., Gaikwad, S.S., Kumar, A., Chandravanshi, K., Makde, R.D. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9oc9 | | Status: | HPUB -- hold until publication | | Title: | Human DHODH in complex with ligand H3D3181 | | Authors: | Arbelaez, M., Purificacao, A.D., Nonato, M.C. | | Deposition date: | 2025-04-23 |
|
| PDBID: | 9obi | | Status: | HPUB -- hold until publication | | Title: | Room Temperature X-Ray Structure of HIV-1 Protease in Complex with Inhibitor GRL-075-24A | | Authors: | Bhandari, D., Kovalevsky, A., Ghosh, A.K. | | Deposition date: | 2025-04-22 | | Sequence: | >Entity 1
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
| PDBID: | 9obk | | Status: | HPUB -- hold until publication | | Title: | A-beta42-Met-R-SO amyloidal fibril | | Authors: | Chan, K.L., Boyer, D., Balasco Serrao, V.H., Raskatov, J.A. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9um3 | | Status: | HPUB -- hold until publication | | Title: | CaPETaseM9 SEC loop of 6CLb variant | | Authors: | Kim, K., Ki, D., Park, J. | | Deposition date: | 2025-04-21 |
|
| PDBID: | 9um5 | | Status: | HPUB -- hold until publication | | Title: | CaPETaseM9 SEC loop of 10CL variant | | Authors: | Kim, K., Ki, D., Park, J. | | Deposition date: | 2025-04-21 |
|
| PDBID: | 9um7 | | Status: | HPUB -- hold until publication | | Title: | CaPETaseM9 SEC loop of 12CL variant | | Authors: | Kim, K., Ki, D., Park, J. | | Deposition date: | 2025-04-21 |
|
| PDBID: | 9um8 | | Status: | HPUB -- hold until publication | | Title: | CaPETaseM9 + P289E variant | | Authors: | Kim, K., Ki, D., Park, J. | | Deposition date: | 2025-04-21 |
|
| PDBID: | 9um6 | | Status: | HPUB -- hold until publication | | Title: | CaPETaseM9 SEC loop of 10CL+E289P variant | | Authors: | Kim, K., Ki, D., Park, J. | | Deposition date: | 2025-04-21 |
|
| PDBID: | 9um4 | | Status: | HPUB -- hold until publication | | Title: | CaPETaseM9 SEC loop of 9CL variant | | Authors: | Kim, K., Ki, D., Park, J. | | Deposition date: | 2025-04-21 |
|
| PDBID: | 9oa9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of anti-MHC-I mAb B1.23.2 Fc domains | | Authors: | Jiang, J., Natarajan, K., Margulies, D.H. | | Deposition date: | 2025-04-20 |
|
| PDBID: | 9oa5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of bovine RPE65 in complex with an emixustat azolog | | Authors: | Kiser, P.D. | | Deposition date: | 2025-04-19 |
|
| PDBID: | 9ujd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a Transaminase PaTA from Pseudonocardia ammonioxydans in complex with PLP and LLP | | Authors: | Zhang, Z.B., Liang, X., Wei, H.L., Liu, W.D., You, S. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9ujq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of HQY1027-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9qy7 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 54e bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-04-17 |
|
