Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9otz
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of Hepatitis C virus envelope glycoprotein HCV-1 E2ecto from genotype 1a bound to neutralizing antibody K568
Authors:Nguyen, T.K.Y., Wilson, I.A.
Deposition date:2025-05-27
PDBID:9otg
Status:HPUB -- hold until publication
Title:Crystal structure of the transpeptidase domain of PBP2 from Neisseria gonorrhoeae strain FA19 acylated by piperacillin
Authors:Stratton, C.M., Bala, S., Davies, C.
Deposition date:2025-05-27
PDBID:9otj
Status:HPUB -- hold until publication
Title:Crystal Structure of Salmonella FraB Deglycase, Crystal Form 1
Authors:Bell, C.E., Zakharova, K.
Deposition date:2025-05-27
PDBID:9otl
Status:HPUB -- hold until publication
Title:Crystal Structure of Salmonella FraB Deglycase, Crystal Form 1
Authors:Bell, C.E., Zakharova, K.
Deposition date:2025-05-27
PDBID:9otr
Status:HPUB -- hold until publication
Title:Crystal Structure of Salmonella FraB Deglycase, Crystal Form 4 with deletion of C-terminal residues 313-325.
Authors:Bell, C.E., Zakharova, K.
Deposition date:2025-05-27
PDBID:9otu
Status:HPUB -- hold until publication
Title:Crystal Structure of Salmonella FraB Deglycase, E214A Mutant, Crystal Form 5
Authors:Bell, C.E., Zakharova, K.
Deposition date:2025-05-27
Sequence:

>Entity 1


MDHHHHHHENLYFQMEPEESMMGMKETVSNIVTSQAEKGGVKHVYYVACGGSYAAFYPAKAFLEKEAKALTVGLYNSGEFINNPPVALGENAVVVVASHKGNTPETIKAAEIARQHGAPVIGLTWIMDSPLVAHCDYVETYTFGDGKDIAGEKTMKGLLSAVELLQQTEGYAHYDDFQDGVSKINRIVWRACEQVAERAQAFAQEYKDDKVIYTVASGAGYGAAYLQSICIFMAMQWIHSACIHSGEFFHGPFEITDANTPFFFQFSEGNTRAVDERALNFLKKYGRRIEVVDAAALGLSTIKTTVIDYFNHSLFNNVYPVYNRALAEARQHPLTTRRYMWKVEY
PDBID:9rcb
Status:HPUB -- hold until publication
Title:Unsheathed flagellar filament in Vibrio alginolyticus
Authors:Qin, K., Einenkel, R., Zhao, W., Erhardt, M., Bergeron, J.R.C.
Deposition date:2025-05-27
PDBID:9rc4
Status:HPUB -- hold until publication
Title:Crystal structure of VirJ domain 1 from Brucella
Authors:Dugelay, C., Ferrarin, S., Terradot, L.
Deposition date:2025-05-27
PDBID:9rcd
Status:HPUB -- hold until publication
Title:Sheathed flagellar filament in Vibrio alginolyticus
Authors:Qin, K., Einenkel, R., Erhardt, M., Bergeron, J.R.C.
Deposition date:2025-05-27
PDBID:9v5r
Status:AUTH -- processed, waiting for author review and approval
Title:cryo-EM structure of trimeric AcrB
Authors:Caliseki, M., Kabasakal, B.V., Schaffitzel, C., Borucu, U., Kadapalakere, S.Y.
Deposition date:2025-05-26
PDBID:9v5h
Status:AUTH -- processed, waiting for author review and approval
Title:cryo-EM structure of hexameric ArnA
Authors:Caliseki, M., Kabasakal, B.V., Schaffitzel, C., Borucu, U., Kadapalakere, S.Y.
Deposition date:2025-05-26
PDBID:9ot6
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the PI4KA complex bound to an EFR3 interfering nanobody (F3IN)
Authors:Shaw, A.L., Suresh, S., Yip, C.K., Burke, J.E.
Deposition date:2025-05-26
PDBID:9ot7
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of Hepatitis C virus envelope glycoprotein Hk6a E2c3 from genotype 6a bound to human neutralizing antibody K509
Authors:Nguyen, T.K.Y., Wilson, I.A.
Deposition date:2025-05-26
PDBID:9osv
Status:HPUB -- hold until publication
Title:Crystal structure of B*27:07-KRA binary complex
Authors:Chaurasia, P., Littler, D.R., Farenc, C., Rossjohn, J.
Deposition date:2025-05-26
PDBID:9osn
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing human antibody K49
Authors:Nguyen, T.K.Y., Wilson, I.A.
Deposition date:2025-05-25
PDBID:9osr
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of Fab HB420 in complex with influenza H3N2 A/Moscow/10/1999 neuraminidase
Authors:Lv, H., Wu, N.C.
Deposition date:2025-05-25
PDBID:9v4e
Status:HPUB -- hold until publication
Title:Crystal Structure of Gallus gallus c-Src Kinase Domain with Point mutation Y416D and Deletion of Residues N414, T417, and R419 Bound to AMP-PNP
Authors:Jain, P., Clifton, B.E., Laurino, P.
Deposition date:2025-05-23
PDBID:9os3
Status:PROC -- to be processed
Title:Human DHODH in complex with ligand H3D2856
Authors:Purificacao, A.D., Nonato, M.C.
Deposition date:2025-05-23
PDBID:9oro
Status:HPUB -- hold until publication
Title:Crystal structure of ProGH158 soaked with laminaritetraose at 1.31 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-05-22
PDBID:9orm
Status:AUTH -- processed, waiting for author review and approval
Title:The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-137
Authors:Burtch, M., Abiodun, W., Litchfield, C., Cartwright, J., Doukov, T., Moody, J.D.
Deposition date:2025-05-22
Release date:2026-05-22
PDBID:9rbf
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of a stalled E. coli 70S RNC-NuoK-86 in complex with the membrane protein insertase SecYEG-YidC
Authors:Rosales-Hernandez, C., Busch, M., Kamel, M., Beckmann, R., Kedrov, A.
Deposition date:2025-05-22
PDBID:9v34
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Crystal structure of DHODH inhibitor HL-006 in complex with DHODH
Authors:Jun, L., Xi, L., Zhaomin, X., Caiyue, C., Yuanyuan, Z.
Deposition date:2025-05-21
PDBID:9v39
Status:HPUB -- hold until publication
Title:Crystal structure of de novo designed serotonin binder SROb2_30
Authors:Yanzhe, Z., Jiao, L., Longxing, C.
Deposition date:2025-05-21
PDBID:9v2w
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the histone deacetylase complex Rpd3L in complex with di-nucleosome
Authors:Zhao, H., Li, H., Wang, C., Yang, X., Li, H., Zou, B., Dong, S., Zhang, N., Zhou, Y., Yi, L., Zhang, Y., Xie, Y., Qin, D., Chao, W., Pei, D., He, J.
Deposition date:2025-05-21
PDBID:9v33
Status:AUTH -- processed, waiting for author review and approval
Title:Calypso/ASX/Ncp complex
Authors:Wang, C., He, J.
Deposition date:2025-05-21

238895

數據於2025-07-16公開中

PDB statisticsPDBj update infoContact PDBjnumon