PDBID: | 9otz | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Hepatitis C virus envelope glycoprotein HCV-1 E2ecto from genotype 1a bound to neutralizing antibody K568 | Authors: | Nguyen, T.K.Y., Wilson, I.A. | Deposition date: | 2025-05-27 |
|
PDBID: | 9otg | Status: | HPUB -- hold until publication | Title: | Crystal structure of the transpeptidase domain of PBP2 from Neisseria gonorrhoeae strain FA19 acylated by piperacillin | Authors: | Stratton, C.M., Bala, S., Davies, C. | Deposition date: | 2025-05-27 |
|
PDBID: | 9otj | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Salmonella FraB Deglycase, Crystal Form 1 | Authors: | Bell, C.E., Zakharova, K. | Deposition date: | 2025-05-27 |
|
PDBID: | 9otl | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Salmonella FraB Deglycase, Crystal Form 1 | Authors: | Bell, C.E., Zakharova, K. | Deposition date: | 2025-05-27 |
|
PDBID: | 9otr | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Salmonella FraB Deglycase, Crystal Form 4 with deletion of C-terminal residues 313-325. | Authors: | Bell, C.E., Zakharova, K. | Deposition date: | 2025-05-27 |
|
PDBID: | 9otu | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Salmonella FraB Deglycase, E214A Mutant, Crystal Form 5 | Authors: | Bell, C.E., Zakharova, K. | Deposition date: | 2025-05-27 | Sequence: | >Entity 1 MDHHHHHHENLYFQMEPEESMMGMKETVSNIVTSQAEKGGVKHVYYVACGGSYAAFYPAKAFLEKEAKALTVGLYNSGEFINNPPVALGENAVVVVASHKGNTPETIKAAEIARQHGAPVIGLTWIMDSPLVAHCDYVETYTFGDGKDIAGEKTMKGLLSAVELLQQTEGYAHYDDFQDGVSKINRIVWRACEQVAERAQAFAQEYKDDKVIYTVASGAGYGAAYLQSICIFMAMQWIHSACIHSGEFFHGPFEITDANTPFFFQFSEGNTRAVDERALNFLKKYGRRIEVVDAAALGLSTIKTTVIDYFNHSLFNNVYPVYNRALAEARQHPLTTRRYMWKVEY
|
|
PDBID: | 9rcb | Status: | HPUB -- hold until publication | Title: | Unsheathed flagellar filament in Vibrio alginolyticus | Authors: | Qin, K., Einenkel, R., Zhao, W., Erhardt, M., Bergeron, J.R.C. | Deposition date: | 2025-05-27 |
|
PDBID: | 9rc4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of VirJ domain 1 from Brucella | Authors: | Dugelay, C., Ferrarin, S., Terradot, L. | Deposition date: | 2025-05-27 |
|
PDBID: | 9rcd | Status: | HPUB -- hold until publication | Title: | Sheathed flagellar filament in Vibrio alginolyticus | Authors: | Qin, K., Einenkel, R., Erhardt, M., Bergeron, J.R.C. | Deposition date: | 2025-05-27 |
|
PDBID: | 9v5r | Status: | AUTH -- processed, waiting for author review and approval | Title: | cryo-EM structure of trimeric AcrB | Authors: | Caliseki, M., Kabasakal, B.V., Schaffitzel, C., Borucu, U., Kadapalakere, S.Y. | Deposition date: | 2025-05-26 |
|
PDBID: | 9v5h | Status: | AUTH -- processed, waiting for author review and approval | Title: | cryo-EM structure of hexameric ArnA | Authors: | Caliseki, M., Kabasakal, B.V., Schaffitzel, C., Borucu, U., Kadapalakere, S.Y. | Deposition date: | 2025-05-26 |
|
PDBID: | 9ot6 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the PI4KA complex bound to an EFR3 interfering nanobody (F3IN) | Authors: | Shaw, A.L., Suresh, S., Yip, C.K., Burke, J.E. | Deposition date: | 2025-05-26 |
|
PDBID: | 9ot7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Hepatitis C virus envelope glycoprotein Hk6a E2c3 from genotype 6a bound to human neutralizing antibody K509 | Authors: | Nguyen, T.K.Y., Wilson, I.A. | Deposition date: | 2025-05-26 |
|
PDBID: | 9osv | Status: | HPUB -- hold until publication | Title: | Crystal structure of B*27:07-KRA binary complex | Authors: | Chaurasia, P., Littler, D.R., Farenc, C., Rossjohn, J. | Deposition date: | 2025-05-26 |
|
PDBID: | 9osn | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing human antibody K49 | Authors: | Nguyen, T.K.Y., Wilson, I.A. | Deposition date: | 2025-05-25 |
|
PDBID: | 9osr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Fab HB420 in complex with influenza H3N2 A/Moscow/10/1999 neuraminidase | Authors: | Lv, H., Wu, N.C. | Deposition date: | 2025-05-25 |
|
PDBID: | 9v4e | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Gallus gallus c-Src Kinase Domain with Point mutation Y416D and Deletion of Residues N414, T417, and R419 Bound to AMP-PNP | Authors: | Jain, P., Clifton, B.E., Laurino, P. | Deposition date: | 2025-05-23 |
|
PDBID: | 9os3 | Status: | PROC -- to be processed | Title: | Human DHODH in complex with ligand H3D2856 | Authors: | Purificacao, A.D., Nonato, M.C. | Deposition date: | 2025-05-23 |
|
PDBID: | 9oro | Status: | HPUB -- hold until publication | Title: | Crystal structure of ProGH158 soaked with laminaritetraose at 1.31 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-05-22 |
|
PDBID: | 9orm | Status: | AUTH -- processed, waiting for author review and approval | Title: | The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-137 | Authors: | Burtch, M., Abiodun, W., Litchfield, C., Cartwright, J., Doukov, T., Moody, J.D. | Deposition date: | 2025-05-22 | Release date: | 2026-05-22 |
|
PDBID: | 9rbf | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of a stalled E. coli 70S RNC-NuoK-86 in complex with the membrane protein insertase SecYEG-YidC | Authors: | Rosales-Hernandez, C., Busch, M., Kamel, M., Beckmann, R., Kedrov, A. | Deposition date: | 2025-05-22 |
|
PDBID: | 9v34 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Crystal structure of DHODH inhibitor HL-006 in complex with DHODH | Authors: | Jun, L., Xi, L., Zhaomin, X., Caiyue, C., Yuanyuan, Z. | Deposition date: | 2025-05-21 |
|
PDBID: | 9v39 | Status: | HPUB -- hold until publication | Title: | Crystal structure of de novo designed serotonin binder SROb2_30 | Authors: | Yanzhe, Z., Jiao, L., Longxing, C. | Deposition date: | 2025-05-21 |
|
PDBID: | 9v2w | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the histone deacetylase complex Rpd3L in complex with di-nucleosome | Authors: | Zhao, H., Li, H., Wang, C., Yang, X., Li, H., Zou, B., Dong, S., Zhang, N., Zhou, Y., Yi, L., Zhang, Y., Xie, Y., Qin, D., Chao, W., Pei, D., He, J. | Deposition date: | 2025-05-21 |
|
PDBID: | 9v33 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Calypso/ASX/Ncp complex | Authors: | Wang, C., He, J. | Deposition date: | 2025-05-21 |
|