| PDBID: | 9wzf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of neuroserpin with a druggable pocket | | Authors: | Akai, D., Onda, M., Mikami, B. | | Deposition date: | 2025-09-29 | | Release date: | 2026-09-29 |
|
| PDBID: | 9wzl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rice protein disulfide isomerase-like protein OsPDIL2-3 a-b domain | | Authors: | Fujimoto, Z., Sakurai, M., Kishine, N., Kawagoe, Y. | | Deposition date: | 2025-09-29 |
|
| PDBID: | 9wzk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the inactive mutant of rice protein disulfide isomerase-like protein OsPDIL2-3 a-b domains | | Authors: | Fujimoto, Z., Sakurai, M., Kishine, N., Kawagoe, Y. | | Deposition date: | 2025-09-29 |
|
| PDBID: | 9ygw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Perdeuterated E. coli YajL, 100K | | Authors: | Lin, J., Kovalevsky, A., Walker, A.R., Wilson, M.A. | | Deposition date: | 2025-09-29 |
|
| PDBID: | 9ygt | | Status: | HPUB -- hold until publication | | Title: | Leucine Rich Repeat Kinase 2 bound to GDP (from GMPPNP data) | | Authors: | Villagran, A., Bodrug, T. | | Deposition date: | 2025-09-29 |
|
| PDBID: | 9sun | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of CRBN-midi in complex with 1-(1-(piperidin-4-yl)-1H-indol-4-yl)dihydropyrimidine-2,4(1H,3H)-dione | | Authors: | Rutter, Z.J., McAulay, K., Ciulli, A. | | Deposition date: | 2025-09-29 |
|
| PDBID: | 9sum | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of Candida auris 80S ribosome in complex with Cycloheximide and Geneticin G418 | | Authors: | Atamas, A., Stetsenko, A., Incarnato, D., Macia Valero, A., Rogachev, A., Billerbeck, S., Guskov, A. | | Deposition date: | 2025-09-29 |
|
| PDBID: | 9sul | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CRYO-EM STRUCTURE OF TRYPANOSOMA BRUCEI BLOODSTREAM FORM 80S RIBOSOME | | Authors: | Rajan, K.S., Yonath, A. | | Deposition date: | 2025-09-29 |
|
| PDBID: | 9suo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | DtxR-like iron-dependent regulator IdeR complexed with cobalt and a mutated consensus DNA-binding sequence | | Authors: | Griese, J.J. | | Deposition date: | 2025-09-29 |
|
| PDBID: | 9wyl | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of quinol dependent Nitric Oxide Reductase with BRIL | | Authors: | Khaja, F., Mboukou, A., Antonyuk, S.V., Muench, S.P., Hasnain, S.S. | | Deposition date: | 2025-09-27 |
|
| PDBID: | 9yg1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Targeting PTPN22 at non-orthosteric binding sites - a fragment approach | | Authors: | Di Lello, P., Wells, M.M. | | Deposition date: | 2025-09-27 |
|
| PDBID: | 9yg2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Targeting PTPN22 at non-orthosteric binding sites - a fragment approach | | Authors: | Di Lello, P., Wells, M.M. | | Deposition date: | 2025-09-27 |
|
| PDBID: | 9yg3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Targeting PTPN22 at non-orthosteric binding sites - a fragment approach | | Authors: | Di Lello, P., Wells, M.M. | | Deposition date: | 2025-09-27 |
|
| PDBID: | 9wyf | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the TC domain of a bifunctional sesterterpene synthase | | Authors: | Lei, Z.Y., Ma, M. | | Deposition date: | 2025-09-26 | | Release date: | 2026-09-26 |
|
| PDBID: | 9yfj | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Double Mutant A49V/Q89H of Human CEACAM1 | | Authors: | Gandhi, A.K., Blumberg, R.S., Huang, Y.H. | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9ssw | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | GroEL-TgCpn20 football complex | | Authors: | Berruezo, A.G., Lopez-Alonso, J.P., Tascon, I., Ubarretxena-Belandia, I. | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9ssx | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | GroEL-PfCpn20 football complex | | Authors: | Berruezo, A.G., Lopez-Alonso, J.P., Tascon, I., Ubarretxena-Belandia, I. | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9wxe | | Status: | HOLD -- hold until a certain date | | Title: | X-ray Crystal Structure of Pseudoazurin Met16Ala variant | | Authors: | Sugai, A., Yamaguchi, T. | | Deposition date: | 2025-09-25 | | Release date: | 2026-09-25 | | Sequence: | >Entity 1
ADFEVHMLNKGKDGAAVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
|
|
| PDBID: | 9wxk | | Status: | HPUB -- hold until publication | | Title: | Linear fragment of lycosin9I with anti-MRSA activity | | Authors: | Mironov, P.A., Dubovskii, P.V., Shenkarev, Z.O. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9yfc | | Status: | PROC -- to be processed | | Title: | Structure of A30P Alpha-synuclein Fibrils | | Authors: | Milchberg, M.H., Warmuth, O.A., Rienstra, C.M. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9yfa | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of the C-terminal DNA-binding domain of BqsR from Pseudomonas aeruginosa | | Authors: | Paredes, A., Singh, H., Smith, A.T. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssd | | Status: | HPUB -- hold until publication | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Penicillin G - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9sse | | Status: | HPUB -- hold until publication | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Ampicillin - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssf | | Status: | HPUB -- hold until publication | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Methicillin - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Cephalexin - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
