PDBID: | 8vcu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactulose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vck | Status: | HPUB -- hold until publication | Title: | Galactose-binding lectin from Mytilus californianus, Isoform 1 (rMcL-1) | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vco | Status: | HPUB -- hold until publication | Title: | Crystal structure of rMcL-1 in complex with N-acetyl-D-galactosamine | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8rfi | Status: | HPUB -- hold until publication | Title: | Ternary complex of HER2/ErbB2 extracellular domain (ECD) in compact conformation with trastuzumab (TZB) antibody | Authors: | Gragera, M., Buschiazzo, A., Vacca, S. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vah | Status: | HPUB -- hold until publication | Title: | E.coli PNPase in complex with single 8-oxoG RNA | Authors: | Kim, W., Zhang, Y.J. | Deposition date: | 2023-12-11 |
|
PDBID: | 8vak | Status: | HPUB -- hold until publication | Title: | E.coli PNPase in complex with double 8-oxoG RNA | Authors: | Kim, W., Zhang, Y.J. | Deposition date: | 2023-12-11 |
|
PDBID: | 8vb3 | Status: | HPUB -- hold until publication | Title: | Dienelactone hydrolase from Solimonas fluminis | Authors: | Schnettler Fernandez, J.D.F., Campbell, E.C., Hollfelder, F. | Deposition date: | 2023-12-11 |
|
PDBID: | 8xch | Status: | HPUB -- hold until publication | Title: | Structural basis for template-product RNA duplex unwinding by SARS-CoV-2 helicase | Authors: | Yan, L., Lou, Z. | Deposition date: | 2023-12-09 |
|
PDBID: | 8xca | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Cas12j19,crRNA and target DNA complex | Authors: | Xi, Z. | Deposition date: | 2023-12-08 |
|
PDBID: | 8xcc | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Cas12j19 (E100K), crRNA and target DNA complex | Authors: | Xi, Z. | Deposition date: | 2023-12-08 |
|
PDBID: | 8rby | Status: | HPUB -- hold until publication | Title: | The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the neutralizing nanobody 1.26 | Authors: | Casasnovas, J.M., Fernandez, L.A., Silva, K. | Deposition date: | 2023-12-05 |
|
PDBID: | 8rap | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Sen1-ADP.BeF3 bound RNA Polymerase II pre-termination complex | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | Deposition date: | 2023-12-01 |
|
PDBID: | 8ran | Status: | HPUB -- hold until publication | Title: | Structure of Sen1-RNA complex | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | Deposition date: | 2023-12-01 |
|
PDBID: | 8rao | Status: | HPUB -- hold until publication | Title: | Structure of Sen1-ADP.BeF3-RNA complex | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | Deposition date: | 2023-12-01 |
|
PDBID: | 8v2w | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the ancestral triosephosphate isomerase reconstruction of the last opisthokont common ancestor obtained by Bayesian inference | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra, Y., Fernandez-Velasco, D.A. | Deposition date: | 2023-11-24 |
|
PDBID: | 8v2x | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the reconstruction of the worst case of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by bayesian inference | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | Deposition date: | 2023-11-24 |
|
PDBID: | 8x6j | Status: | HPUB -- hold until publication | Title: | The X-ray structure of N-terminal catalytic domain of Thermoplasma acidophilum tRNA methyltransferase Trm56 (Ta0931) in complex with S-adenosyl-L-methionine | Authors: | Fukumoto, S., Hasegawa, T., Ototake, M., Moriguchi, S., Namba, M., Yamagamai, R., Kawamura, T., Hirata, A., Hori, H. | Deposition date: | 2023-11-21 |
|
PDBID: | 8v19 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | RNA polymerase II elongation complex with Syn conformation 8-oxoguanine with AMP added | Authors: | Oh, J., Wang, D. | Deposition date: | 2023-11-20 |
|
PDBID: | 8v1a | Status: | HPUB -- hold until publication | Title: | RNA polymerase II elongation complex with 8-oxoguanine and ATP in two different conformation: 8OG (syn)-ATP (A site) and 8OG (anti)-ATP (E site) | Authors: | Oh, J., Wang, D. | Deposition date: | 2023-11-20 |
|
PDBID: | 8v18 | Status: | HPUB -- hold until publication | Title: | RNA polymerase II elongation complex with 8-oxoguanine with bound AMPCPP | Authors: | Oh, J., Wang, D. | Deposition date: | 2023-11-20 |
|
PDBID: | 8v0a | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the worst case of the reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood with PGH | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | Deposition date: | 2023-11-17 |
|
PDBID: | 8uzr | Status: | HPUB -- hold until publication | Title: | RNA polymerase II elongation complex with 8-oxoguanine with bound CMPCPP | Authors: | Oh, J., Wang, D. | Deposition date: | 2023-11-16 |
|
PDBID: | 8uzs | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | RNA polymerase II elongation complex with 8-oxoguanine with 3'' CTP added | Authors: | Oh, J., Wang, D. | Deposition date: | 2023-11-16 |
|
PDBID: | 8uzq | Status: | HPUB -- hold until publication | Title: | RNA polymerase II elongation complex with 8-oxoguanine in +1 active site | Authors: | Oh, J., Wang, D. | Deposition date: | 2023-11-16 |
|
PDBID: | 8uy5 | Status: | HPUB -- hold until publication | Title: | [ZP] Self-assembling DNA crystal with expanded genetic code using C,A,T,G, Z and P nucleotides | Authors: | Vecchioni, S., Sha, R., Ohayon, Y.P., Hernandez, C. | Deposition date: | 2023-11-13 |
|