| PDBID: | 9vw0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vwb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vw1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vw2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vw3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vw5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vw6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vvt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the LysR-type transcriptional regulator CutR from mycobacterium sp. strain JC1 | | Authors: | Cho, H.J., Kang, B.S. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vw9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PA3774 in complex with YF221315 | | Authors: | Qin, F., Yang, G.F. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vvu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the LysR-type transcriptional regulator CutR from mycobacterium sp. strain JC1 | | Authors: | Cho, H.J., Lee, K.Y., Kang, B.S. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vvm | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of a transmembrane protein | | Authors: | Ning, Y., Ge, J. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vvv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vwd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human glutaminyl-peptide cyclotransferase with I321A mutation, in complex with (E)-3-(2-methoxyphenyl)-6-((5-(prop-1-en-1-yl)-1H-imidazol-1-yl)methyl)pyridin-2(1H)-one | | Authors: | Li, G.-B., Ning, X.-L. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vwa | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vw8 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E.coli transcription initiation complex with Escherichia phage Mu late transcription activator C using the PI promoter DNA | | Authors: | Lin, W. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vvo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9s06 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9s0f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9s08 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9s04 | | Status: | HPUB -- hold until publication | | Title: | PYCR1 in complex with 1-(2,4-Difluorophenyl)-2-(1H-1,2,4-triazol-1- yl)ethanone | | Authors: | Ragin-Oh, W., Czerwonka, D., Ruszkowski, M. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9s0e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9s07 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9s09 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9s0a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-16 | | Release date: | 2026-07-16 | | Sequence: | >Entity 1
VRPEDLGTGLLEALLRGDLAGAEALFRRGLRFWGPEGVLEHLLLPVLREVGEAWHRGEIGVAEEHLASTFLRARLQELLDLAGFPPGPPVLVTTPPGERHEIGAMLAAYHLRRKGVPALYLGPDTPLPDLRALARRLGAGAVVLSAVLSEPLRALPDGALKDLAPRVFLGGQGAGPEEARRLGAEYMEDLKGLAEALWLPRGPEKEAIGHHHHHH
|
|
