PDBID: | 9pmy | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9pmm | Status: | HPUB -- hold until publication | Title: | Crystal structure of C. elegans PUF-3 in complex with RNA I-1 | Authors: | Zhang, Y., Hall, T.M.T. | Deposition date: | 2025-07-18 |
|
PDBID: | 9pmz | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9pml | Status: | HPUB -- hold until publication | Title: | Crystal structure of 6A7 in complex with Kdo | Authors: | Li, W., Evans, S.V. | Deposition date: | 2025-07-18 |
|
PDBID: | 9pmt | Status: | HPUB -- hold until publication | Title: | Structure of an anti-VHH fab fragment bound to nanobody Nb33 | Authors: | Srinivasan, K., Wan, Y., Manglik, A. | Deposition date: | 2025-07-18 |
|
PDBID: | 9pms | Status: | AUTH -- processed, waiting for author review and approval | Title: | Epitope editing of CD90 protects hematopoietic stem cells from immunotherapy and enables targeted enrichment for gene therapy | Authors: | Choo, S., Radtke, S., Rupert, P.B., Tong, A.H., Swing, K., Repele, A., Starrs, M., Humphreys, T., Darari, A., Strong, R.K., Keim, H.P. | Deposition date: | 2025-07-18 |
|
PDBID: | 9pmo | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-07-18 | Release date: | 2026-07-18 |
|
PDBID: | 9pn1 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Q108K:K40L:T51V:T53C:R58W:T29L:Y19W:Q4A mutant of cellular retinol binding protein II complex with 15-cis-retinal | Authors: | Ehyaei, N., Silva, K., Bingham, C., Geiger, J.H., Borhan, B. | Deposition date: | 2025-07-18 | Sequence: | >Entity 1 TRDANGTWEMESNENFEGWMKALDIDFALRKIAVRLTQTLVIDQDGDNFKVKCTSTFWNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKKWIEGDKLYLELTCGDQVCRQVFKKK
|
|
PDBID: | 9pmq | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-07-18 | Release date: | 2026-07-18 |
|
PDBID: | 9pmu | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9pmr | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9pmv | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9pmx | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9pn2 | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9pn3 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-18 |
|
PDBID: | 9vx4 | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9vx5 | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9vx8 | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9vx2 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-07-18 |
|
PDBID: | 9vx3 | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9vxa | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9vxb | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9vxc | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9vxd | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-18 |
|
PDBID: | 9vx7 | Status: | HPUB -- hold until publication | Title: | Transcription factor | Authors: | Kim, H.J. | Deposition date: | 2025-07-18 |
|