Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9fi9
Status:HPUB -- hold until publication
Title:Human PIF + Z48847594 (OCCUPANCY 0.7)
Authors:Bax, B.D., Sanders, C.M., Antson, A.A., Brandao-Neto, J.
Deposition date:2024-05-28
PDBID:9bwe
Status:HPUB -- hold until publication
Title:Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine at pH 6.4 in an intermediate state
Authors:Kindig, K., Gibbs, E., Chakrapani, S.
Deposition date:2024-05-21
PDBID:9bwj
Status:HPUB -- hold until publication
Title:Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine and 0.1 mM zinc in an apo state
Authors:Kindig, K., Gibbs, E., Chakrapani, S.
Deposition date:2024-05-21
PDBID:8zkl
Status:AUTH -- processed, waiting for author review and approval
Title:The structure of vibrio cholerae phage VP1 capsid protein
Authors:Liu, H.R., Pang, H.
Deposition date:2024-05-16
Release date:2025-05-16
PDBID:8zjp
Status:AUTH -- processed, waiting for author review and approval
Title:Drimenyl diphosphate synthase SsDMS_Y505I&D303A from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+
Authors:Pan, X.M., Dong, S.M., Dong, L.B.
Deposition date:2024-05-15
PDBID:8zg5
Status:HPUB -- hold until publication
Title:Drimenyl diphosphate synthase SsDMS_Y505I&D303A from Streptomyces showdoensis (Apo)
Authors:Pan, X.M., Dong, S.M., Dong, L.B.
Deposition date:2024-05-09
PDBID:8zgv
Status:HPUB -- hold until publication
Title:Drimenyl diphosphate synthase SsDMS_F248A&D303E from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+
Authors:Pan, X.M., Dong, S.M., Dong, L.B.
Deposition date:2024-05-09
PDBID:8zgw
Status:HPUB -- hold until publication
Title:Drimenyl diphosphate synthase SsDMS_F248Y&D303E from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+
Authors:Pan, X.M., Dong, S.M., Dong, L.B.
Deposition date:2024-05-09
PDBID:8zg1
Status:HPUB -- hold until publication
Title:Drimenyl diphosphate synthase SsDMS_F248Y&D303E from Streptomyces showdoensis (Apo)
Authors:Pan, X.M., Dong, S.M., Dong, L.B.
Deposition date:2024-05-08
PDBID:9f8w
Status:HPUB -- hold until publication
Title:Crystal structure of the apo Pex5 peroxisomal cargo receptor from Trypanosoma brucei
Authors:Banasik, M.K., Dubin, G.
Deposition date:2024-05-07
PDBID:7h63
Status:AUTH -- processed, waiting for author review and approval
Title:THE 1.65 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 4-[(5-fluoro-3-propan-2-yl-1H-indol-2-yl)-phenylmethyl]-3-hydroxy-2-propan-2-yl-1,2-dihydropyrrol-5-one (VINYLOGOUS ACID)
Authors:Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H.
Deposition date:2024-04-19
PDBID:7h65
Status:AUTH -- processed, waiting for author review and approval
Title:THE 1.8 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH N-[1-[2-[[2-hydroxy-3-methyl-3-(4-methylphenyl)-4-oxocyclobuten-1-yl]-phenylmethyl]-6-methyl-1H-indol-3-yl]-2-methylpropan-2-yl]acetamide
Authors:Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H.
Deposition date:2024-04-19
PDBID:9f0k
Status:HPUB -- hold until publication
Title:Poliovirus type 1 (strain Mahoney) expanded conformation stabilised virus-like particle (PV1 SC6b) from a mammalian expression system
Authors:Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I.
Deposition date:2024-04-16
PDBID:9f02
Status:HPUB -- hold until publication
Title:HIV-1 envelope glycoprotein (BG505 gp140 SOSIP.664) trimer in complex with three copies of ELC07 broadly neutralizing antibody.
Authors:Hope, J., Alguel, Y., Nans, A., Cherepanov, P.
Deposition date:2024-04-15
PDBID:9ez0
Status:HPUB -- hold until publication
Title:Poliovirus type 1 (strain Mahoney) expanded conformation stabilised virus-like particle (PV1 SC6b) from a yeast expression system.
Authors:Bahar, M.W., Sherry, L., Stonehouse, N.J., Rowlands, D.J., Fry, E.E., Stuart, D.I.
Deposition date:2024-04-10
PDBID:8yye
Status:HPUB -- hold until publication
Title:Crystal structure of lipase CTL (Caldibacillus Thermoamylovorans)
Authors:Pan, S.Y., Lan, D.M., Wang, Y.H.
Deposition date:2024-04-03
PDBID:9b7y
Status:HPUB -- hold until publication
Title:Cryo-EM structure of TetR regulator Mce3R from Mycobacterium tuberculosis bound to a DNA oligonucleotide
Authors:Panagoda, N., Sampson, N.
Deposition date:2024-03-28
PDBID:8ypc
Status:HPUB -- hold until publication
Title:Cryo-EM structure of human pannexin 3 in phosphorylated state
Authors:Hang, Z., Huawei, Z., Daping, W.
Deposition date:2024-03-16
PDBID:9ep2
Status:HPUB -- hold until publication
Title:Crystal structure of the complex of human carbonic anhydrase I with 4-sulfamoylphenyl 3-(p-tolylthio)propanoate
Authors:Angeli, A., Ferraroni, M.
Deposition date:2024-03-16
Sequence:

>Entity 1


MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
PDBID:9b2q
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of Pantothenate Synthetase from Candida albicans.
Authors:Regan, J., Avad, K.A., Alaidi, O., Seetharaman, J., Palmer, G.E., Hevener, K.E.
Deposition date:2024-03-15
PDBID:9axo
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Crystal Structure of Antibody HY11-7E1_Ch2 Fab in Complex with Fentanyl
Authors:Rodarte, J.V., Pancera, M.
Deposition date:2024-03-06
PDBID:9axn
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Crystal Structure of Anti-Fentanyl Antibody HY11-6B2_Mu Fab in Complex with Fentanyl
Authors:Rodarte, J.V., Pancera, M.
Deposition date:2024-03-06
PDBID:9axr
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Crystal Structure of HY18-5B1_Ch Fab in Complex with Fentanyl
Authors:McGovern, M.R., Rodarte, J.V., Pancera, M.
Deposition date:2024-03-06
PDBID:8yc2
Status:AUTH -- processed, waiting for author review and approval
Title:Cyanophage Pan5 capsid asymmetric unit
Authors:Zhu, J., Li, Q., Zhou, C.Z.
Deposition date:2024-02-17
PDBID:8yc5
Status:AUTH -- processed, waiting for author review and approval
Title:Cyanophage Pan5 cement-on-penton
Authors:Zhu, J., Li, Q., Zhou, C.Z.
Deposition date:2024-02-17

224931

數據於2024-09-11公開中

PDB statisticsPDBj update infoContact PDBjnumon