Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9u7o
Status:HPUB -- hold until publication
Title:Tetrameric cystathionine beta-synthase of Mycobacterium tuberculosis bound to AOAA
Authors:Roy, A., Polepalli, S., Mondal, B., Dutta, S.
Deposition date:2025-03-25
PDBID:9u7n
Status:HPUB -- hold until publication
Title:Tetrameric cystathionine beta-synthase of Mycobacterium tuberculosis bound to O-Benzylhydroxylamine
Authors:Polepalli, S., Roy, A., Mondal, B., Dutta, S.
Deposition date:2025-03-25
PDBID:9nx4
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of a P. Aeruginosa Gyrase Chimera In Complex with 20mer DNA and Ciprofloxacin
Authors:Pedersen, L.C., Doetsch, P.W., Garcia-Villada, L., Degtyareva, N., Perera, U.L.
Deposition date:2025-03-25
PDBID:9nx5
Status:HPUB -- hold until publication
Title:Crystal Structure of a P. Aeruginosa Gyrase
Authors:Pedersen, L.C., Doetsch, P.W., Garcia-Villada, L., Degtyareva, N., Perera, U.L.
Deposition date:2025-03-25
PDBID:9qnm
Status:HPUB -- hold until publication
Title:Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2
Authors:Useini, A., Strater, N., Kuenze, G., Sonnendecker, C.
Deposition date:2025-03-25
PDBID:9qns
Status:HPUB -- hold until publication
Title:APH(2'''')-IVa with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C.
Deposition date:2025-03-25
PDBID:9qnn
Status:HPUB -- hold until publication
Title:APH(2'''')-IVa with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C.
Deposition date:2025-03-25
PDBID:9qnu
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Crystal structure of Nanofitin C10 - fused to a coiled-coil domain - in complex with a C2 symmetric 31unit aromatic oligoamide foldamer
Authors:Sigl, J.C., Wang, L., Douat, C., Huc, I.
Deposition date:2025-03-25
PDBID:9qnq
Status:HPUB -- hold until publication
Title:APH(2'''')-Id with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C.
Deposition date:2025-03-25
PDBID:9qnw
Status:HPUB -- hold until publication
Title:APH(2'''')-IVa with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., kowalewski, J., Lionne, C.
Deposition date:2025-03-25
Sequence:

>Entity 1


MGSSHHHHHHSSGLVPRGSHMRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSIKIK
PDBID:9qny
Status:HPUB -- hold until publication
Title:APH(2'''')-Id with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., KowaleWski, J., Lionne, C.
Deposition date:2025-03-25
PDBID:9qnx
Status:HPUB -- hold until publication
Title:APH(2'''')-IVa with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C.
Deposition date:2025-03-25
PDBID:9u7g
Status:HPUB -- hold until publication
Title:FGFR1 kinase domain with a macrocyclic compound 8g
Authors:Chen, X.J., Chen, Y.H.
Deposition date:2025-03-24
PDBID:9nww
Status:AUTH -- processed, waiting for author review and approval
Title:Single-particle cryo-EM structure of the first variant of mobilized colistin resistance (MCR-1) in its ligand-bound state
Authors:Zinkle, A.P., Bunuro-Batista, M., Herrera, C.M., Erramilli, S.K., Kloss, B., Ashraf, K.U., Nosol, K., Zhang, G., Cater, R.J., Marty, M.T., Kossiakoff, A.A., Trent, M.S., Nygaard, R., Stansfeld, P.J., Mancia, F.
Deposition date:2025-03-24
PDBID:9nwl
Status:HPUB -- hold until publication
Title:Crystal structure of glycine-betaine demethylase subunit GbcA from Pseudomonas aeruginosa
Authors:Tan, K., Joachimiak, A., Munoz-Clares, R.A.
Deposition date:2025-03-24
PDBID:9nwx
Status:HPUB -- hold until publication
Title:Discovery of a Small Molecule ITK and Pan-TRK Kinase Inhibitor (PF-07245303) for the Potential Topical Treatment of Atopic Dermatitis
Authors:Liu, S.
Deposition date:2025-03-24
PDBID:7i90
Status:HPUB -- hold until publication
Title:Crystal Structure of 7 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i91
Status:HPUB -- hold until publication
Title:Crystal Structure of 13 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i92
Status:HPUB -- hold until publication
Title:Crystal Structure of 9 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i93
Status:HPUB -- hold until publication
Title:Crystal Structure of 27 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i95
Status:HPUB -- hold until publication
Title:Crystal Structure of 25 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i96
Status:HPUB -- hold until publication
Title:Crystal Structure of 4 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i97
Status:HPUB -- hold until publication
Title:Crystal Structure of 8 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i98
Status:HPUB -- hold until publication
Title:Crystal Structure of 10 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i99
Status:HPUB -- hold until publication
Title:Crystal Structure of 22 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24

243911

數據於2025-10-29公開中

PDB statisticsPDBj update infoContact PDBjnumon