| PDBID: | 8yde | | Status: | HOLD -- hold until a certain date | | Title: | E.coli transcription translation coupling complex in TTC-B state 1 (subclass 3) containing mRNA with 39-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-02-20 | | Release date: | 2025-08-20 |
|
| PDBID: | 8ydi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | E.coli transcription translation coupling complex in TTC-P state 1 (subclass 2) containing mRNA with 39-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-02-20 | | Release date: | 2025-08-20 |
|
| PDBID: | 8ydg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | E.coli transcription translation coupling complex in TTC-B state 3 (subclass2) containing mRNA with 39-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-02-20 | | Release date: | 2025-08-20 |
|
| PDBID: | 8ydf | | Status: | HOLD -- hold until a certain date | | Title: | E.coli transcription translation coupling complex in TTC-B state 1 (subclass 2) containing mRNA with 39-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-02-20 | | Release date: | 2025-08-20 |
|
| PDBID: | 8ydh | | Status: | HOLD -- hold until a certain date | | Title: | E.coli transcription translation coupling complex in TTC-P state 1 (subclass1) containing mRNA with 39-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-02-20 | | Release date: | 2025-08-20 |
|
| PDBID: | 8ydj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | E.coli transcription translation coupling complex in TTC-P containing mRNA with 39-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-02-20 | | Release date: | 2025-08-20 |
|
| PDBID: | 8s1d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the influenza A matrix protein 1 peptide 100-114 in complex with HLA-DRB1*04:04 | | Authors: | Sharma, R.K., Dubnovitsky, A., Gerstner, C., Boddul, S., James, T., Turcinov, S., Horuluoglu, B., Andriopoulos, P., Kozhukh, G., Achour, A., Wermeling, F., Kwok, W.W., Ronnblom, L., Klareskog, L., James, E., Padyukov, L., Malmstrom, V. | | Deposition date: | 2024-02-15 | | Release date: | 2025-08-15 |
|
| PDBID: | 8rxm | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Galectin-3 in complex with thiogalactoside derivative | | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | | Deposition date: | 2024-02-07 |
|
| PDBID: | 8y5s | | Status: | HOLD -- hold until a certain date | | Title: | E.coli Transcription translation coupling complex in TTC-B state 5 (subclass 2) containing mRNA with 27-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and GDPCP | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-01-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 8y5o | | Status: | HOLD -- hold until a certain date | | Title: | E.coli transcription translation coupling complex in TTC-B state 3 (subclass1) containing mRNA with 30-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-01-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 8y5p | | Status: | HOLD -- hold until a certain date | | Title: | E.coli transcription translation coupling complex in TTC-B state 4 (subclass 1) containing mRNA with 24-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-01-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 8y5q | | Status: | HOLD -- hold until a certain date | | Title: | E.coli transcription translation coupling complex in TTC-B state 4 (subclass 2) containing mRNA with 27-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and GDPCP | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-01-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 8y5r | | Status: | HOLD -- hold until a certain date | | Title: | E.coli Transcription translation coupling complex in TTC-B state 5 (subclass 1) containing mRNA with 27-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and fusidic acid | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-01-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 8y5m | | Status: | HOLD -- hold until a certain date | | Title: | E.coli transcription translation coupling complex in TTC-B state 2 containing mRNA with 27-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-01-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 8y5n | | Status: | HOLD -- hold until a certain date | | Title: | E.coli transcription translation coupling complex in TTC-A state 3 containing mRNA with 21-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-01-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 8y5k | | Status: | HOLD -- hold until a certain date | | Title: | E.coli transcription translation coupling complex in TTC-A state 2 containing mRNA with 27-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-01-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 8y5t | | Status: | HOLD -- hold until a certain date | | Title: | E.coli Transcription translation coupling complex in TTC-B state 5 (subclass 3) containing mRNA with 27-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and fusidic acid | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-01-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 8rtu | | Status: | HPUB -- hold until publication | | Title: | TaGST-10 in complex with deoxynivalenol-13-glutathione | | Authors: | Michlmayr, H., Papageorgiou, A.C. | | Deposition date: | 2024-01-29 | | Release date: | 2025-07-29 |
|
| PDBID: | 8vrp | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer bound to 4-Quinazolinone Scaffold inhibitor | | Authors: | Goldstone, D.C., Walsham, L. | | Deposition date: | 2024-01-22 | | Release date: | 2025-07-21 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
| PDBID: | 8voo | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 39 nt long spacer, ops signal, RfaH, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-15 | | Release date: | 2025-07-16 |
|
| PDBID: | 8vop | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation coupled complex (TTC-B) containing mRNA with a 36 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-15 | | Release date: | 2025-07-16 |
|
| PDBID: | 8voq | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 39 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-15 | | Release date: | 2025-07-16 |
|
| PDBID: | 8vor | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 51 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-15 | | Release date: | 2025-07-16 |
|
| PDBID: | 8vl1 | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 36 nt long spacer, ops signal, RfaH, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-07-16 |
|
| PDBID: | 8ric | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of oligosaccharide dehydrogenase from Pycnoporus cinnabarinus bound to Sinapic Acid, tetragonal crystal | | Authors: | Savino, C., Sciara, G., Gugole, E., Vallone, B., Fata, F., Bulfaro, G., Costanzo, A., Montemiglio, L.C. | | Deposition date: | 2023-12-18 | | Release date: | 2025-06-18 |
|
