| PDBID: | 9dq0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of apo HrmJ from Streptomyces sp. CFMR 7 | | Authors: | Zheng, Y.-C., Chang, W.-C., Swartz, P. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9dq1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HrmJ from Streptomyces sp. CFMR 7 (HrmJ-ssc) complexed with manganese (II), 2-oxoglutarate and 6-nitronorleucine | | Authors: | Zheng, Y.-C., Swartz, P., Chang, W.-C. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9dq2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HrmJ from Streptomyces sp. CFMR 7 (HrmJ-ssc) complexed with vanadyl(IV)-oxo, succinate and 6-nitronorleucine | | Authors: | Zheng, Y.-C., Chang, W.-C. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9dq6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | TREK2-HH in complex with Nb76, copper(II) and phosphatidylserine | | Authors: | Bahramimoghaddam, H., Laganowsky, A. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9dq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9dqa | | Status: | PROC -- to be processed | | Title: | Crystal structure of bovine RPE65 in complex with PG90 | | Authors: | Kiser, P.D., Bassetto, M. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9dq9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9dqb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9dqd | | Status: | PROC -- to be processed | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9gv5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jmz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jn0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jmy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-09-22 | | Release date: | 2025-09-22 |
|
| PDBID: | 9jn3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AvpGT in complex with Ara-A | | Authors: | Li, J.H., Wang, Z.Q., Zhang, Z.Y., Chen, W.Q. | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jn4 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-09-22 | | Release date: | 2025-09-22 |
|
| PDBID: | 9jn5 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-09-22 | | Release date: | 2025-09-22 |
|
| PDBID: | 9jn6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-22 | | Release date: | 2025-09-22 |
|
| PDBID: | 9jn1 | | Status: | PROC -- to be processed | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jn2 | | Status: | PROC -- to be processed | | Title: | Multidrug resistance-associated protein 2 in complex with AMP-PNP in active state | | Authors: | Chen, D.D., Zhao, P. | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jn7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human ALK2 kinase domain with R206H mutation in complex with RK783 | | Authors: | Sakai, N., Mishima-Tsumagari, C., Shirouzu, M. | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jn8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9dpm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9dpl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9gv3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex between Nb474 mutant R53A,D125A and Trypanosoma congolense fructose-1,6-bisphosphate aldolase | | Authors: | McNae, I.W., Dornan, J., Walkinshaw, M.D. | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9gv4 | | Status: | HPUB -- hold until publication | | Title: | TBA G-quadruplex binding nanobody (free form) | | Authors: | Pevec, M., Hadzi, S. | | Deposition date: | 2024-09-21 | | Sequence: | >Entity 1
QVQLQESGGGLVQAGGSLRLSCAASGSRFSSNTMTWYRQAPGKQREWVATMRSIGTTRYASSVEGRFTLSRDNAKNTVYLQMNSLKPEDTAVYYCNLRRGGGIYWGQGTQVTVSSHHHHHH
|
|
