| PDBID: | 9mnf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of FBXW7 in complex with XS839193 | | Authors: | Perez, J.G., Ahmad, H., Wang, X., Sun, J., Dong, A., Seitova, A., Arrowsmith, C.H., Edwards, A.M., Peng, H., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-12-21 |
|
| PDBID: | 9hub | | Status: | HPUB -- hold until publication | | Title: | D11 mAbs bound to alpha-Bungarotoxin at pH 7.5 | | Authors: | Wade, J.W., Bohn, M.F., Laustsen, A.H., Morth, J.P. | | Deposition date: | 2024-12-21 |
|
| PDBID: | 9htz | | Status: | HPUB -- hold until publication | | Title: | M2-32, a new class A acid phosphatase | | Authors: | Gavira, J.A., Ramos, J.L., Martinez-Rodriguez, S., Recio, M.I., de la Torre, J. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9hu1 | | Status: | HPUB -- hold until publication | | Title: | SSX structure of cytochrome c prime beta from Methylococcus capsulatus (Bath) | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9hu8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Kalirin/Rac1 in complex with MC-278. | | Authors: | Callens, M.C., Thompson, A.P., Gray, J.L., von Delft, F., Brennan, P.E. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9l4m | | Status: | HPUB -- hold until publication | | Title: | Structure of bifunctional Ylehd at pH 8 from Yarrowia lipolytica | | Authors: | Yadav, L.R., Vanarase, K.N., Inamdar, S.S., Mande, S.C., Kumar, A.R. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9mmf | | Status: | HPUB -- hold until publication | | Title: | First structure of Five-tetrad G-Quadruplex | | Authors: | Eyiolowope, J., Xing, E.R., Yatsunyk, L.A. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9ht7 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site and A-site tRNAs | | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of YIUA from Yersinia ruckeri with Iron and nitrilotriacetic acid | | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hs9 | | Status: | HPUB -- hold until publication | | Title: | Cytochrome P460 from Methyloccocus capsulatus (unclear crosslink from Lys), damage-free | | Authors: | Pfalzgraf, H.E., Adams, H.R., Sugimoto, H., Tosha, T., Horrell, S., Jaho, S., Beilsten-Edmands, J., Tews, I., Worrall, J.A.R., Owen, R.L., Hough, M.A. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htc | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 1600 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PA0884, the SBP component of a Pseudomonas aeruginosa PAO1 Tripartite ATP-independent Periplasmic (TRAP) transporter, complexed with itaconate | | Authors: | Herman, R., Mehboob, J., Elston, R., Afolabi, H., Kinniment-Williams, B.E., Wilkinson, A.J., Thomas, G.H. | | Deposition date: | 2024-12-19 | | Sequence: | >Entity 1
AQPIVIKFSHVVAENTPKGQGALLFKKLVEQRLGGRVEVDVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTRKVQIFDLPFLFDDIQAVDRFQRSPQGRALLTSMQGKGILGLAYWHNGMKQLSANRPLLEPEDARGLKFRVQASDVLNEQFRQLRAISRKMSFAEVYQGLQTGVVNGTENTWSNYESQKVNEVQKYFTESNHGLVDYMVITNAKFWNGLPADIREELQRIMDEVTVQVNLEAERLNRDARQRILASGASEIHTLSPQQRADWRQAMQPVWQKFRGNVGADLLQAAEASNRPD
|
|
| PDBID: | 9htt | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 0.19 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htv | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 0.95 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9l3q | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 PT Spike Protein complex with a potent broad-spectrum macrocyclic peptide inhibitor 6L3-3P11K | | Authors: | Wang, M., Yang, J.Y., Peng, Q., Shi, Y. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mle | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Asp49 Phospholipase A2 isolated from Lachesis muta | | Authors: | Leonardo, D.A., Vargas, J.A., Pereira, H.M., Garratt, R.C. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mld | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the Portal Protein from Finegoldia magna phage Miquella | | Authors: | Harlington, A.H., Fechner, M.R., Hao, N., Shearwin, K.E., Whelan, F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlj | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease covalently bound to compound GRL-050-23 at 1.6 A | | Authors: | Beechboard, S.N., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-12-19 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVT(CSO)GTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD(CSO)VSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9hrs | | Status: | HPUB -- hold until publication | | Title: | ZnT1 CTD regulation | | Authors: | Ben-Yosef, T.E., Zarivach, R., Shahar, A. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hs8 | | Status: | HPUB -- hold until publication | | Title: | Cytochrome c prime beta from Methylococcus capsulatus (Bath) in complex with nitric oxide from proli NONOate | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hrk | | Status: | HPUB -- hold until publication | | Title: | Cytochrome P460 from Methyloccocus capsulatus in the ferrous state (single crosslink from Lys) | | Authors: | Pfalzgraf, H.E., Adams, H.R., Jaho, S., Hough, M.A. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hrl | | Status: | HPUB -- hold until publication | | Title: | NbE34 a VHH binding human neutrophil elastase | | Authors: | Redeghieri, P., Dumoulin, M., Kerff, F. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hrj | | Status: | HPUB -- hold until publication | | Title: | Structure of YIUA from Yersinia ruckeri | | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hrp | | Status: | HPUB -- hold until publication | | Title: | Structure of YIUA from Yersinia ruckeri with iron | | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | | Deposition date: | 2024-12-18 | | Sequence: | >Entity 1
SENITDMAGRSVVIPAKVERILLGEGRLFYAVSLLEGQKPFDRIVGWQGDFRKLDTQTYAVYKAKFPQVDNIPLIGNTTADSISPEKVLTLNPDIAIFGLSGHGPGKNSELVKQLEKAGVPVVFVDFRTSPLKNTLPSMRVLGKVLHREQQANDYIKFYEDNVRKVTEITSKIPADKKPSVFIELRAGAMEECCGTAGKGNMGDFIDQAGGNNMAKNLLPGALGTVNLEKVLSTNPDIYIASGGKAPDNNAPGVSLGAQVTKEQAQSSLQTILDRKGINTLSAVKNGRSYGIWHNFYNSPYNVLAIQSFAKWFYPQQFADLDPNNTMNSLYSQFLAIEPTGTYWVDSTK
|
|
| PDBID: | 9hs4 | | Status: | HPUB -- hold until publication | | Title: | Cytochrome P460 from Methyloccocus capsulatus (double crosslink from Lys) | | Authors: | Pfalzgraf, H.E., Adams, H.R., Mikolajek, H., Sanchez-Weatherby, J., Sandy, J., Hough, M.A. | | Deposition date: | 2024-12-18 |
|
