PDBID: | 9mo1 | Status: | HPUB -- hold until publication | Title: | LINE-1 Reverse Transcriptase bound to a DNA primer RNA template duplex and triphosphate nucleoside inhibitor as the incoming base | Authors: | Nichols, C., Viacava Follis, A. | Deposition date: | 2024-12-24 |
|
PDBID: | 9hv3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human GSK3b in complex with ARN25657 | Authors: | Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l63 | Status: | HPUB -- hold until publication | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | Authors: | Jiang, J., Fang, P. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l64 | Status: | HPUB -- hold until publication | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | Authors: | Jiang, J., Fang, P. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l65 | Status: | HPUB -- hold until publication | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | Authors: | Jiang, J., Fang, P. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l6e | Status: | HPUB -- hold until publication | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | Authors: | Jiang, J., Fang, P. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l6m | Status: | HPUB -- hold until publication | Title: | Crystal Structure of BRD2 BD1 domain in complex with small molecule inhibitor Isoxazole azepine compound. | Authors: | Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K. | Deposition date: | 2024-12-24 | Sequence: | >Entity 1 MGSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
|
|
PDBID: | 9l6p | Status: | HPUB -- hold until publication | Title: | Cryo-electron microscopic structure of a highly efficient ochratoxin detoxification enzyme LlADH | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., Niu, D., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Guo, R.-T., Chen, C.-C. | Deposition date: | 2024-12-24 |
|
PDBID: | 9huj | Status: | AUTH -- processed, waiting for author review and approval | Title: | CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in complex with heparin oligomer (12 subunits) | Authors: | Bereta, G.P., Bielecka, E., Biela, A.P., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T. | Deposition date: | 2024-12-23 |
|
PDBID: | 9hui | Status: | HPUB -- hold until publication | Title: | CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in complex with heparin oligomer (20 subunits). | Authors: | Bereta, G., Bielecka, E., Biela, A., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T. | Deposition date: | 2024-12-23 |
|
PDBID: | 9huh | Status: | HPUB -- hold until publication | Title: | CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in 10 mM calcium | Authors: | Bereta, G.P., Bielecka, E., Biela, A.P., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T. | Deposition date: | 2024-12-23 |
|
PDBID: | 9hus | Status: | HOLD -- hold until a certain date | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 31, with P-site tRNAs | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | Deposition date: | 2024-12-23 | Release date: | 2025-12-23 |
|
PDBID: | 9huq | Status: | HPUB -- hold until publication | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site tRNA | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | Deposition date: | 2024-12-23 |
|
PDBID: | 9huk | Status: | HPUB -- hold until publication | Title: | Crystal structure of human GSK3b in complex with ARN24161 | Authors: | Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G. | Deposition date: | 2024-12-23 |
|
PDBID: | 9hul | Status: | HPUB -- hold until publication | Title: | Crystal structure of human GSK3b in complex with ARN25423 | Authors: | Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G. | Deposition date: | 2024-12-23 |
|
PDBID: | 9mnq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM10-30 | Authors: | Nguyen, T.K.Y., Wilson, I.A. | Deposition date: | 2024-12-23 |
|
PDBID: | 9mnt | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-73 | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | Deposition date: | 2024-12-23 |
|
PDBID: | 9mns | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-36 | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | Deposition date: | 2024-12-23 |
|
PDBID: | 9mnu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM11-48 | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | Deposition date: | 2024-12-23 |
|
PDBID: | 9huo | Status: | HPUB -- hold until publication | Title: | A01 mAbs bound to cobratoxin at pH 5.5 | Authors: | Wade, J.W., Bohn, M.F., Laustsen, A.H., Morth, J.P. | Deposition date: | 2024-12-23 |
|
PDBID: | 9l5x | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of Klebsiella pneumoniae Enoyl-Acyl Carrier Protein Reductase (FabI) in complex with Triclosan | Authors: | Biswas, S., Patra, A., Kushwaha, G.S., Suar, M. | Deposition date: | 2024-12-23 | Release date: | 2025-12-23 |
|
PDBID: | 9l61 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of BRD2 BD2 domain in complex with small molecule inhibitor Mivebresib ABBV-075 | Authors: | Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K. | Deposition date: | 2024-12-23 | Sequence: | >Entity 1 MGSSHHHHHHSSGLVPRGSHSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
|
|
PDBID: | 9hud | Status: | HPUB -- hold until publication | Title: | Alpha-1-antitrypsin in the cleaved conformation in complex with a conformationally nonselective Fab fragment | Authors: | Irving, J.A., Aldobiyan, I.F. | Deposition date: | 2024-12-22 |
|
PDBID: | 9huc | Status: | HPUB -- hold until publication | Title: | The glucuronyl esterase OtCE15A from Opitutus terrae in complex with a heptasaccharide | Authors: | Oestberg, E.B., Lo Leggio, L., Zaghini, A., Mazurkewich, S., Larsbrink, J. | Deposition date: | 2024-12-21 | Sequence: | >Entity 1 GHSAYTLPDPLVGADGTRVHDRATWQHRRRPELLQLFAREVYGRTPLGRPEGMVFKVTTMEHAALGGAATRKEVTVRFGRDPNAPSMQLLLYVPNAVIARAERAPVFLGLNFYGNHTVHTDPAIALSARWIPAEAPNGANHRATEAARGSDAQKWPVEQILARGYAVATVYCGDLCPDRPDGLNASVASWLDAAAGDQRAPDAWGAIGVWAWGLSRALDYLETDPLVDASRVAVHGHSRLGKAALWAGAQDDRFALVISNESGCGGAALSKRIHGETVARINTVFPHWFARNFRRYDDHEEALPVDQHELLALVAPRPLYVASAEDDDWADPRGEFLAVKAAEPVFRLFGQTGPSGEDVPRVNEPSGGALRYHIRPGPHGMTAQDWAFYLAFADEWLKSALPA
|
|
PDBID: | 9mne | Status: | HPUB -- hold until publication | Title: | Crystal structure of enteropathogenic Escherichia coli EspC | Authors: | Pilapitiya, A.U., Heras, B., Paxman, J.J. | Deposition date: | 2024-12-21 |
|