| PDBID: | 9qw6 | | Status: | HPUB -- hold until publication | | Title: | Urate Oxidase from Aspergillus Flavus with its Substrate Uric Acid by continuous serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9uhk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the catalytic domain of USP7 bound to a hPiT1 peptide | | Authors: | Wang, S.-C., Sun, Y.-J. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6p | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro S113C in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o72 | | Status: | HPUB -- hold until publication | | Title: | Structure of turkey hemoglobin A covalently bound with epigallocatechin gallate | | Authors: | Bingman, C.A., Yin, J., Smith, R.W., Richards, M.P. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o74 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro L115M in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6q | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro L115A in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o70 | | Status: | HPUB -- hold until publication | | Title: | Motif1-Motif2, two domain left-handed parallel G-quadruplex | | Authors: | Xing, E.R., Yatsunyk, L.A. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qw1 | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qvy | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme complex with mannose-1-phosphate (M1P) | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qw0 | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose and Bis-Tris | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9o6e | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro S10C in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9o6f | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro S113A in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qvu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepI-(1,5)-KdoI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-12 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qvw | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme native | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9o6d | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro S10A in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9qv8 | | Status: | HPUB -- hold until publication | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2-A186S | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9qva | | Status: | HPUB -- hold until publication | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2-P155G-A186S | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9qux | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the Homer1 EVH1 domain | | Authors: | Czajlik, A., Maruzs, B., Fanni, F., Batta, G., Gaspari, Z., Peterfia, B.F. | | Deposition date: | 2025-04-11 | | Sequence: | >Entity 1
GSHMGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQ
|
|
| PDBID: | 9o6a | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of EcKatG S-Trp105 at 2.22 Angstrom resolution revealing an asymmetric sulfur center in O=S-Trp | | Authors: | Duan, R., Li, J., Nathan, B., Yang, X., Liu, A. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9o65 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SHOC2-KRAS-PP1CA (SKP) complex | | Authors: | Finci, L.I., Bonsor, D.A., Simanshu, D.K. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9qud | | Status: | HPUB -- hold until publication | | Title: | Cu(II)-bound de novo protein scaffold TFD-EH | | Authors: | Wagner Egea, P., Delhommel, F., Mustafa, G., Leiss-Maier, F., Klimper, L., Badmann, T., Heider, A., Wille, I.C., Groll, M., Sattler, M., Zeymer, C. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9quf | | Status: | HPUB -- hold until publication | | Title: | Structure of a fungal Ube2O | | Authors: | Kordic, D., Williams, T.L., Luiza Deszcz, L., Ehrmann, J., Arnese, R., Meinhart, A., Clausen, T. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9qug | | Status: | HPUB -- hold until publication | | Title: | Structure of a UBC-Ubiquitin conjugate | | Authors: | Kordic, D., Williams, T.L., Luiza Deszcz, L., Ehrmann, J., Arnese, R., Meinhart, A., Clausen, T. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9quc | | Status: | HPUB -- hold until publication | | Title: | Metal-free de novo protein scaffold TFD-EH | | Authors: | Wagner Egea, P., Delhommel, F., Mustafa, G., Leiss-Maier, F., Klimper, L., Badmann, T., Heider, A., Wille, I.C., Groll, M., Sattler, M., Zeymer, C. | | Deposition date: | 2025-04-10 | | Sequence: | >Entity 1
GAMGDILIVWAKDVDEMLKQVEILRRLGAKQIAVESSDWRILQEALKKGGDILIVNGGGMTITFRGDDLEALLKAAIEMIKQALKFGATITLSLDGNDLNINITGVPEQVRKELAKEAERLAKEFGITVTRTGGGDVDEMLKQVEILRRLGAKQIAVHSDDWRILQEALKKG
|
|
| PDBID: | 9que | | Status: | HPUB -- hold until publication | | Title: | Structure of human MTH1 in complex with 8DG by continuous serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-10 |
|
