| PDBID: | 9lsv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of T2R-TTL-W66 Complex | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9ls9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of T2R-TTL-Q3 Ccomplex | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9lsb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of T2R-TTL-Q20 Ccomplex | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9lse | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of T2R-TTL-Q31 Ccomplex | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n54 | | Status: | HPUB -- hold until publication | | Title: | Bipartite p63 NLS in complex with Importin Alpha 2 | | Authors: | Esmaeili, S., Swarbrick, C.M.D., Forwood, J.K. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4b | | Status: | HPUB -- hold until publication | | Title: | RhoA GTPase R70A bound to GTPgammaS | | Authors: | Marcus, K., Mattos, C. | | Deposition date: | 2025-02-02 |
|
| PDBID: | 9n43 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of none-heme iron enzyme (TqaM) from Trichoderma atroviride bound with iron | | Authors: | Liu, S., Zheng, Y.-C., Chang, W.-C. | | Deposition date: | 2025-02-01 |
|
| PDBID: | 9n45 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of none-heme iron enzyme (TqaM) from Trichoderma atroviride bound with iron and 2-aminoisobutyric acid | | Authors: | Liu, S., Zheng, Y.-C., Chang, W.-C. | | Deposition date: | 2025-02-01 |
|
| PDBID: | 9lrs | | Status: | HOLD -- hold until a certain date | | Title: | The structure of MRGPRX4 with PSB-18061 | | Authors: | Cao, C., Roth, B.L. | | Deposition date: | 2025-02-01 | | Release date: | 2026-02-01 |
|
| PDBID: | 9n3t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the CasMINI-sgRNA-target DNA complex | | Authors: | Wang, H., Xu, X., Wang, C., Qi, L.S. | | Deposition date: | 2025-01-31 |
|
| PDBID: | 9n3w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the CasMINI-sgRNA-target DNA complex | | Authors: | Wang, H., Xu, X., Wang, C., Qi, L.S. | | Deposition date: | 2025-01-31 |
|
| PDBID: | 9n3k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the CasMINI-sgRNA-target DNA complex | | Authors: | Wang, H., Xu, X., Wang, C., Qi, L.S. | | Deposition date: | 2025-01-31 |
|
| PDBID: | 9i79 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Xylose Isomerase collected at 20C using time-resolved serial synchrotron crystallography with Glucose at 180 seconds | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., TellKamp, F., Mehrabi, P. | | Deposition date: | 2025-01-31 |
|
| PDBID: | 9n2w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Dienelactone hydrolase family protein SaDLH from Solimonas aquatica | | Authors: | Schnettler Fernandez, J.D.F., Campbell, E.C., Hollfelder, F. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9n2v | | Status: | HPUB -- hold until publication | | Title: | Designed anti-OSM Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Watkins, A.M., Seeger, F., Frey, N.C., Bonneau, R., Regev, A., Hofmann, J.L., Gligorijevic, V. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i61 | | Status: | HPUB -- hold until publication | | Title: | Transient activated state of BetP in complex with betaine | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i66 | | Status: | HPUB -- hold until publication | | Title: | Downregulated state of the betaine transporter BetP | | Authors: | Heinz, V., Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i5y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ADP-bound BiP ATPase domain in complex with CDNF C-terminal domain | | Authors: | Fudo, S., Shpironok, O., Saarma, M., Kajander, T. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i60 | | Status: | HPUB -- hold until publication | | Title: | Transient activated state of BetP | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i5z | | Status: | HPUB -- hold until publication | | Title: | Upregulated state of BetP in potassium | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Horn, G., Ziegler, C. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i5f | | Status: | HPUB -- hold until publication | | Title: | Glyceraldehyde 3-phosphate dehydrogenase A (GAPDHA) NAD holoenzyme, from Helicobacter pylori | | Authors: | Foster, S.P., Moody, P.C.E. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9mzv | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lp2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed amantadine induced heterodimer dAID23.4 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9mzc | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R. | | Deposition date: | 2025-01-22 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGRSMKLSCAASGFIFSNYGMAWVRQAPKKGLEWVAYINYDGGTTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTTGYYYDGSYYYDRFVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
>Entity 2
DIQMTQSPSFLSASEGERVTLNCRASQNINKYLDWYQQKLGEAPKLLIYNTNNLHTGIPSRFSGSGSGTDYTITISSLQPEDVATYFCLQRNSWYTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
| PDBID: | 9i3b | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 8s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 | | Release date: | 2026-07-22 |
|
