| PDBID: | 9i79 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Xylose Isomerase collected at 20C using time-resolved serial synchrotron crystallography with Glucose at 180 seconds | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., TellKamp, F., Mehrabi, P. | | Deposition date: | 2025-01-31 |
|
| PDBID: | 9n2v | | Status: | HPUB -- hold until publication | | Title: | Designed anti-OSM Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Watkins, A.M., Seeger, F., Frey, N.C., Bonneau, R., Regev, A., Hofmann, J.L., Gligorijevic, V. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9n2w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Dienelactone hydrolase family protein SaDLH from Solimonas aquatica | | Authors: | Schnettler Fernandez, J.D.F., Campbell, E.C., Hollfelder, F. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i5y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ADP-bound BiP ATPase domain in complex with CDNF C-terminal domain | | Authors: | Fudo, S., Shpironok, O., Saarma, M., Kajander, T. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i60 | | Status: | HPUB -- hold until publication | | Title: | Transient activated state of BetP | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i5z | | Status: | HPUB -- hold until publication | | Title: | Upregulated state of BetP in potassium | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Horn, G., Ziegler, C. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i61 | | Status: | HPUB -- hold until publication | | Title: | Transient activated state of BetP in complex with betaine | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i66 | | Status: | HPUB -- hold until publication | | Title: | Downregulated state of the betaine transporter BetP | | Authors: | Heinz, V., Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i5f | | Status: | HPUB -- hold until publication | | Title: | Glyceraldehyde 3-phosphate dehydrogenase A (GAPDHA) NAD holoenzyme, from Helicobacter pylori | | Authors: | Foster, S.P., Moody, P.C.E. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9n20 | | Status: | HPUB -- hold until publication | | Title: | Structure of C3d Bound to a Fragment of FHR-2 and S. aureus Efb-C | | Authors: | Duan, H., Geisbrecht, B.V. | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9mzv | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lp2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed amantadine induced heterodimer dAID23.4 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9mzc | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R. | | Deposition date: | 2025-01-22 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGRSMKLSCAASGFIFSNYGMAWVRQAPKKGLEWVAYINYDGGTTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTTGYYYDGSYYYDRFVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
>Entity 2
DIQMTQSPSFLSASEGERVTLNCRASQNINKYLDWYQQKLGEAPKLLIYNTNNLHTGIPSRFSGSGSGTDYTITISSLQPEDVATYFCLQRNSWYTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
| PDBID: | 9i38 | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the de novo designed monoheme protein m4D2 with bound iron(III) 2,4-dimethyldeuteroporphyrin IX | | Authors: | Williams, C., Hutchins, G.H., Molinaro, P.M., Berrones-Reyes, J.C., Lichtenstein, B.R., Koder, R.L., Anderson, J.L.R. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3d | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 10s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 | | Release date: | 2026-07-22 |
|
| PDBID: | 9i3a | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 6s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 | | Release date: | 2026-07-22 |
|
| PDBID: | 9i3b | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 8s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 | | Release date: | 2026-07-22 |
|
| PDBID: | 9i3c | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 10s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 | | Release date: | 2026-07-22 |
|
| PDBID: | 9lo8 | | Status: | HPUB -- hold until publication | | Title: | Twenty-two polymer Msp1 from S.cerevisiae(with a catalytic dead mutation) in complex with an unknown peptide substrate | | Authors: | Chengdong, H., Simin, W., Xuan, C. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9lnt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed amantadine induced homotrimer mAIT03 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9lns | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed amantadine induced homotrimer dAIT17 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9ln7 | | Status: | HPUB -- hold until publication | | Title: | Alpha-7 nicotinic acetylcholine receptor bound to inhibitory bicyclic peptide KP2007 in a resting state. | | Authors: | Chen, H., Sun, D., Tian, C. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9lmh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LooH in complex with FAD | | Authors: | Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9lmi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LooH in complex with Trp | | Authors: | Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9lmg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LooH | | Authors: | Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z. | | Deposition date: | 2025-01-19 |
|
