| PDBID: | 9ogw | | Status: | HPUB -- hold until publication | | Title: | Identification of ligands for E3 ligases using fragment-based methods | | Authors: | Phan, J., Fesik, S.W. | | Deposition date: | 2025-05-02 |
|
| PDBID: | 9ogv | | Status: | HPUB -- hold until publication | | Title: | Identification of ligands for E3 ligases using fragment-based methods | | Authors: | Phan, J., Fesik, S.W. | | Deposition date: | 2025-05-02 |
|
| PDBID: | 9ofr | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF THE HUMAN IGA1 FC FRAGMENT-FC-ALPHA RECEPTOR (CD89) COMPLEX | | Authors: | Korzeniowski, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9ofs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human IGA2m2 FC fragment-FC-alpha receptor (CD89) complex | | Authors: | Chandravanshi, M., Korzeniowski, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9oc9 | | Status: | HPUB -- hold until publication | | Title: | Human DHODH in complex with ligand H3D3181 | | Authors: | Arbelaez, M., Purificacao, A.D., Nonato, M.C. | | Deposition date: | 2025-04-23 |
|
| PDBID: | 9o8r | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of NI06063_d30_103 Fab in complex with influenza virus hemagglutinin from A/Michigan/45/2015 (H1N1) | | Authors: | Jo, G., Ward, A.B. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of NI04359_d30_240 Fab in complex with influenza virus hemagglutinin from A/Michigan/45/2015 (H1N1) | | Authors: | Jo, G., Ward, A.B. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qwv | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma cruzi enoyl-CoA hydratase | | Authors: | Brannigan, J.A., Dodson, E.J. | | Deposition date: | 2025-04-15 | | Sequence: | >Entity 1
MLRKSLFLLNSMDPIVKYAQKGAVVTLTLNRPKQLNALNAELTNALAEKLLKCDADPSVSVLIITGEGRSFVAGADIKAMANQTFVEFYKHNMLRGLDTIAAVRKPIIAAVNGFALGGGCELAMSCDIVVASEKAIFGQPEIKIGTIPGAGGTQRLTRLIGKSKAMEWILTGEQYTAEEAERAGLVSRVVRHEELLPTVSAMAEKIALNSPLAVSLAKDCINKALETTLAQGMAYEQRTFQATFATDDQKEGMAAFVEKRKPNFKNA
|
|
| PDBID: | 9uik | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CCR8 in ligand free state resolved via the fusion/crosslinking strategy | | Authors: | Han, S.C., Li, M.H. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qw3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepIII-HepII-HepI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qw2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepII-HepI-PhosI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qw4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic PhosII-HepII-HepI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9o72 | | Status: | HPUB -- hold until publication | | Title: | Structure of turkey hemoglobin A covalently bound with epigallocatechin gallate | | Authors: | Bingman, C.A., Yin, J., Smith, R.W., Richards, M.P. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9uhu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human adenosine A2A receptor in ligand free state resolved using the fusion/crosslinking strategy | | Authors: | Han, S.C., Li, M.H. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qvu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepI-(1,5)-KdoI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-12 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9ufc | | Status: | HOLD -- hold until a certain date | | Title: | Structural of a glutamate cysteine ligase StGSH1 in Solanum tuberosum | | Authors: | Zhao, H.B., Fan, S.L. | | Deposition date: | 2025-04-10 | | Release date: | 2026-04-10 |
|
| PDBID: | 9uap | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of ligand-free active-state M1 muscarinic acetylcholine receptor with alpha5 helix of G11 protein complex | | Authors: | Zhang, X., Gao, K., Liu, X. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9nys | | Status: | HPUB -- hold until publication | | Title: | Human DNA Ligase 1 E346A/E592A/K845N triple mutant with 3''-A:T nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2025-03-28 |
|
| PDBID: | 9nww | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Single-particle cryo-EM structure of the first variant of mobilized colistin resistance (MCR-1) in its ligand-bound state | | Authors: | Zinkle, A.P., Bunuro-Batista, M., Herrera, C.M., Erramilli, S.K., Kloss, B., Ashraf, K.U., Nosol, K., Zhang, G., Cater, R.J., Marty, M.T., Kossiakoff, A.A., Trent, M.S., Nygaard, R., Stansfeld, P.J., Mancia, F. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qk7 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 1 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qk8 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 2 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qk9 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 3 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkd | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 7 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qke | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 8 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkf | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 9 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
