Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9opp
Status:HPUB -- hold until publication
Title:HLA-A*02:01 SCT with Cathepsin G peptide, FLLPTGAEA
Authors:Finton, K.A.K., Mak, A., Ban, B., Kulesha, A.
Deposition date:2025-05-19
PDBID:9v0l
Status:HPUB -- hold until publication
Title:UDP-binding PsBGluT, a tetrahydrobiopterin glucosyltransferase from Pseudanabaena sp. Chao 1811
Authors:Zang, R.J., Jiang, Y.L., Zhou, C.Z.
Deposition date:2025-05-18
PDBID:9r8p
Status:HPUB -- hold until publication
Title:Cryo-EM structure of hSA3, a mutated hyper-soluble human serum albumin designed for bacterial expression
Authors:De Felice, S., Cendron, L.
Deposition date:2025-05-16
PDBID:9r88
Status:HPUB -- hold until publication
Title:CTE Type I tau filament from the brain of a football player
Authors:Qi, C., Scheres, H.W.S., Goedert, M.
Deposition date:2025-05-16
PDBID:9r89
Status:HPUB -- hold until publication
Title:CTE Type II tau filament from the brain of a football player
Authors:Qi, C., Scheres, H.W.S., Goedert, M.
Deposition date:2025-05-16
PDBID:9r8a
Status:HPUB -- hold until publication
Title:PHF tau filament from the brain of a football player
Authors:Qi, C., Scheres, H.W.S., Goedert, M.
Deposition date:2025-05-16
PDBID:9r8d
Status:HPUB -- hold until publication
Title:SF tau filament from the brain of a football player
Authors:Qi, C., Scheres, H.W.S., Goedert, M.
Deposition date:2025-05-16
PDBID:9oow
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the heterotetrameric complex formed by two subunits of YrvO and two subunits of MnmA bound to tRNA-Glu
Authors:Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H.
Deposition date:2025-05-16
PDBID:9oov
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the heterotrimeric complex formed by two subunits of YrvO and a subunit of MnmA bound to tRNA-Glu
Authors:Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H.
Deposition date:2025-05-16
Release date:2026-11-15
PDBID:9uz6
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of E. coli glycine decarboxylase (P-protein) apo
Authors:Han, Z., Zeng, A.
Deposition date:2025-05-16
Release date:2026-05-16
PDBID:9r82
Status:HPUB -- hold until publication
Title:6-Helix Bundle - with a Clasp (6HB-C)-monomer with 2''-Fluoro-modified pyrimidines (FY RNA)
Authors:Kristoffersen, E.L., Andersen, E.S., Zwergius, N.H.
Deposition date:2025-05-15
PDBID:9oo6
Status:HPUB -- hold until publication
Title:Human PORCN bound to inhibitor C59
Authors:Black, K.A., Venugopal, H., Glukhova, A.
Deposition date:2025-05-15
PDBID:9onx
Status:AUTH -- processed, waiting for author review and approval
Title:Full length LRRK2 active form 2 (class8)
Authors:Villagran-Suarez, A., Leschziner, A.
Deposition date:2025-05-15
PDBID:9oo8
Status:HPUB -- hold until publication
Title:Apo Human PORCN
Authors:Black, K.A., Venugopal, H., Glukhova, A.
Deposition date:2025-05-15
PDBID:9oo5
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the dimeric YrvO cysteine desulfurase
Authors:Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H.
Deposition date:2025-05-15
PDBID:9ooa
Status:HPUB -- hold until publication
Title:Crystal structure of MYST acetyltransferase domain in complex with inhibitor 7
Authors:Hermans, S.J., Suwandi, A., Parker, M.W., Baell, J.B.
Deposition date:2025-05-15
PDBID:9ont
Status:HOLD -- hold until a certain date
Title:Structure of a P-loop mutant PTP-like myo-inositol phosphatase from Selenomonas ruminantium in complex with myo-inositol hexakisphosphate
Authors:Cleland, C.P., Mosimann, S.C.
Deposition date:2025-05-15
Release date:2025-11-15
PDBID:9onu
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of a P-loop mutant PTP-like myo-inositol phosphatase from Selenomonas ruminantium in complex with myo-inositol-(1,2,4,5,6)-pentakisphosphate
Authors:Cleland, C.P., Mosimann, S.C.
Deposition date:2025-05-15
Release date:2025-11-15
PDBID:9oo7
Status:HPUB -- hold until publication
Title:Human PORCN bound to inhibitor ETC159
Authors:Black, K.A., Venugopal, H., Glukhova, A.
Deposition date:2025-05-15
PDBID:9uyr
Status:HPUB -- hold until publication
Title:In situ structure of egg-white lysozyme using a goniometer-compatible chip-based platform
Authors:Ghosh, S.
Deposition date:2025-05-15
PDBID:9uyu
Status:HPUB -- hold until publication
Title:Egg-white lysozyme at cryogenic temperature using a goniometer-compatible chip-based platform
Authors:Ghosh, S.
Deposition date:2025-05-15
PDBID:9uyt
Status:HPUB -- hold until publication
Title:DNA duplex containing gold-mediated 2-thio-cytosine base pairs
Authors:Kondo, J., Kosugi, K., Sugawara, A.
Deposition date:2025-05-15
PDBID:9r7b
Status:HPUB -- hold until publication
Title:Structure and mechanism of the broad spectrum CRISPR-associated ring nuclease Crn4
Authors:McMahon, S.A., White, M.F., Gloster, T.M.
Deposition date:2025-05-14
Sequence:

>Entity 1


GANAMAMASLINLTPHDVTVFDGDTPIASWPASGTFARIMEDVAAPAPMDTDQGFVPVSQVRYADTVDGLPGKVSGTAYLVSRVLAAAVPRDDLYFPLDEVRDATGRIIGCRALGQFDHSHTEERGDA
PDBID:9r79
Status:HPUB -- hold until publication
Title:Imine Reductase IR91 from Kribbella flavida with NADP+ and 5-methoxy-2-tetralone
Authors:Srinivas, K., Gilio, A.K., Grogan, G.
Deposition date:2025-05-14
PDBID:9r7a
Status:HPUB -- hold until publication
Title:Imine Reductase IR91 from Kribbella flavida with NADP+ and 5-methoxy-(S)-2-(N-methylamino)tetralin
Authors:Srinivas, K., Gilio, A.K., Grogan, G.
Deposition date:2025-05-14

243911

數據於2025-10-29公開中

PDB statisticsPDBj update infoContact PDBjnumon