| PDBID: | 9opp | | Status: | HPUB -- hold until publication | | Title: | HLA-A*02:01 SCT with Cathepsin G peptide, FLLPTGAEA | | Authors: | Finton, K.A.K., Mak, A., Ban, B., Kulesha, A. | | Deposition date: | 2025-05-19 |
|
| PDBID: | 9v0l | | Status: | HPUB -- hold until publication | | Title: | UDP-binding PsBGluT, a tetrahydrobiopterin glucosyltransferase from Pseudanabaena sp. Chao 1811 | | Authors: | Zang, R.J., Jiang, Y.L., Zhou, C.Z. | | Deposition date: | 2025-05-18 |
|
| PDBID: | 9r8p | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of hSA3, a mutated hyper-soluble human serum albumin designed for bacterial expression | | Authors: | De Felice, S., Cendron, L. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9r88 | | Status: | HPUB -- hold until publication | | Title: | CTE Type I tau filament from the brain of a football player | | Authors: | Qi, C., Scheres, H.W.S., Goedert, M. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9r89 | | Status: | HPUB -- hold until publication | | Title: | CTE Type II tau filament from the brain of a football player | | Authors: | Qi, C., Scheres, H.W.S., Goedert, M. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9r8a | | Status: | HPUB -- hold until publication | | Title: | PHF tau filament from the brain of a football player | | Authors: | Qi, C., Scheres, H.W.S., Goedert, M. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9r8d | | Status: | HPUB -- hold until publication | | Title: | SF tau filament from the brain of a football player | | Authors: | Qi, C., Scheres, H.W.S., Goedert, M. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9oow | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the heterotetrameric complex formed by two subunits of YrvO and two subunits of MnmA bound to tRNA-Glu | | Authors: | Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9oov | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the heterotrimeric complex formed by two subunits of YrvO and a subunit of MnmA bound to tRNA-Glu | | Authors: | Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H. | | Deposition date: | 2025-05-16 | | Release date: | 2026-11-15 |
|
| PDBID: | 9uz6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of E. coli glycine decarboxylase (P-protein) apo | | Authors: | Han, Z., Zeng, A. | | Deposition date: | 2025-05-16 | | Release date: | 2026-05-16 |
|
| PDBID: | 9r82 | | Status: | HPUB -- hold until publication | | Title: | 6-Helix Bundle - with a Clasp (6HB-C)-monomer with 2''-Fluoro-modified pyrimidines (FY RNA) | | Authors: | Kristoffersen, E.L., Andersen, E.S., Zwergius, N.H. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9oo6 | | Status: | HPUB -- hold until publication | | Title: | Human PORCN bound to inhibitor C59 | | Authors: | Black, K.A., Venugopal, H., Glukhova, A. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9onx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Full length LRRK2 active form 2 (class8) | | Authors: | Villagran-Suarez, A., Leschziner, A. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9oo8 | | Status: | HPUB -- hold until publication | | Title: | Apo Human PORCN | | Authors: | Black, K.A., Venugopal, H., Glukhova, A. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9oo5 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the dimeric YrvO cysteine desulfurase | | Authors: | Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9ooa | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MYST acetyltransferase domain in complex with inhibitor 7 | | Authors: | Hermans, S.J., Suwandi, A., Parker, M.W., Baell, J.B. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9ont | | Status: | HOLD -- hold until a certain date | | Title: | Structure of a P-loop mutant PTP-like myo-inositol phosphatase from Selenomonas ruminantium in complex with myo-inositol hexakisphosphate | | Authors: | Cleland, C.P., Mosimann, S.C. | | Deposition date: | 2025-05-15 | | Release date: | 2025-11-15 |
|
| PDBID: | 9onu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a P-loop mutant PTP-like myo-inositol phosphatase from Selenomonas ruminantium in complex with myo-inositol-(1,2,4,5,6)-pentakisphosphate | | Authors: | Cleland, C.P., Mosimann, S.C. | | Deposition date: | 2025-05-15 | | Release date: | 2025-11-15 |
|
| PDBID: | 9oo7 | | Status: | HPUB -- hold until publication | | Title: | Human PORCN bound to inhibitor ETC159 | | Authors: | Black, K.A., Venugopal, H., Glukhova, A. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9uyr | | Status: | HPUB -- hold until publication | | Title: | In situ structure of egg-white lysozyme using a goniometer-compatible chip-based platform | | Authors: | Ghosh, S. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9uyu | | Status: | HPUB -- hold until publication | | Title: | Egg-white lysozyme at cryogenic temperature using a goniometer-compatible chip-based platform | | Authors: | Ghosh, S. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9uyt | | Status: | HPUB -- hold until publication | | Title: | DNA duplex containing gold-mediated 2-thio-cytosine base pairs | | Authors: | Kondo, J., Kosugi, K., Sugawara, A. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9r7b | | Status: | HPUB -- hold until publication | | Title: | Structure and mechanism of the broad spectrum CRISPR-associated ring nuclease Crn4 | | Authors: | McMahon, S.A., White, M.F., Gloster, T.M. | | Deposition date: | 2025-05-14 | | Sequence: | >Entity 1 GANAMAMASLINLTPHDVTVFDGDTPIASWPASGTFARIMEDVAAPAPMDTDQGFVPVSQVRYADTVDGLPGKVSGTAYLVSRVLAAAVPRDDLYFPLDEVRDATGRIIGCRALGQFDHSHTEERGDA
|
|
| PDBID: | 9r79 | | Status: | HPUB -- hold until publication | | Title: | Imine Reductase IR91 from Kribbella flavida with NADP+ and 5-methoxy-2-tetralone | | Authors: | Srinivas, K., Gilio, A.K., Grogan, G. | | Deposition date: | 2025-05-14 |
|
| PDBID: | 9r7a | | Status: | HPUB -- hold until publication | | Title: | Imine Reductase IR91 from Kribbella flavida with NADP+ and 5-methoxy-(S)-2-(N-methylamino)tetralin | | Authors: | Srinivas, K., Gilio, A.K., Grogan, G. | | Deposition date: | 2025-05-14 |
|