| PDBID: | 9n2h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the Mtb NapA bound to 16mer AT rich DNA | | Authors: | Schumacher, M.A. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9i5f | | Status: | HPUB -- hold until publication | | Title: | Glyceraldehyde 3-phosphate dehydrogenase A (GAPDHA) NAD holoenzyme, from Helicobacter pylori | | Authors: | Foster, S.P., Moody, P.C.E. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9i5i | | Status: | HPUB -- hold until publication | | Title: | PR1 phage heterodimeric DNA ligase in complex with 21-mer nicked DNA (random sequence) | | Authors: | Richardson, J.M., MacNeill, S.A. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9i5e | | Status: | HPUB -- hold until publication | | Title: | A Coiled Coil Module Strategy for High-Resolution Cryo-EM Structures of Small Proteins for Drug Discovery | | Authors: | Samson, C., Dossou, I., Steinmetz, A., Kumar, A., Mathieu, M., Rak, A. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9i5n | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo electron microscopy of a Fab fragment bound to recombinant human CD40 ligand | | Authors: | Kristoffersen, E.L., Schinkel, T., Andersen, E.S. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9i5j | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND 27 | | Authors: | Walter, A., Atz, K., Stenzhorn, Y., Nippa, D., Grether, U., Kuhn, B., Martin, R., Benz, J. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9lql | | Status: | HPUB -- hold until publication | | Title: | Structure of STG-hydrolyzing beta-glucosidase 1 (PSTG1) complexed with heptyl 1-thio-beta-D-glucopyranoside | | Authors: | Yanai, T., Arai, A., Takahashi, Y., Imaizumi, R., Takeshita, K., Matsuura, H., Sakai, N., Takahashi, S., Yamamoto, M., Kataoka, K., Nakayama, T., Yamashita, S. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9n20 | | Status: | HPUB -- hold until publication | | Title: | Structure of C3d Bound to a Fragment of FHR-2 and S. aureus Efb-C | | Authors: | Duan, H., Geisbrecht, B.V. | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9n22 | | Status: | HPUB -- hold until publication | | Title: | Y20S (Sec18-Sec17-Sec9-Sso1-Snc1) EDTA - Class 2 | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9n1v | | Status: | HPUB -- hold until publication | | Title: | High-resolution crystal structure of methyl-2,3-diamino propanoic acid-AMS inhibitor bound adenylation domain (A3) from Sulfazecin nonribosomal peptide synthetase SulM | | Authors: | Patel, K.D., Gulick, A.M. | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9n1z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of C3d Bound to a Fragment of FHR-2 | | Authors: | Duan, H., Geisbrecht, B.V. | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9i56 | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND 23 | | Authors: | Walter, A., Atz, K., Stenzhorn, Y., Nippa, D., Grether, U., Kuhn, B., Martin, R., Benz, J. | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9i4r | | Status: | HPUB -- hold until publication | | Title: | N-terminal Oic streptag II in Sav E44V-S45T-V47R-D67A-K121R variant | | Authors: | Wang, W., Lau, K., Pojer, F., Larabi, A. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9i4s | | Status: | HPUB -- hold until publication | | Title: | DtpB in complex with photocaged nitric oxide, 1.24 s, 64.4 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9i4u | | Status: | HPUB -- hold until publication | | Title: | DtpB in complex with photocaged nitric oxide, 1.24 s, 32.2 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpv | | Status: | HPUB -- hold until publication | | Title: | Neutron structure of GH1 beta-glucosidase Td2F2 2F-Glc complex at room temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpx | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of GH1 beta-glucosidase Td2F2 2F-Glc complex at room temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpy | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of GH1 beta-glucosidase Td2F2 2F-Glc complex at cryogenic temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9i4q | | Status: | HPUB -- hold until publication | | Title: | SSX structure of dye-type peroxidase DtpB from Streptomyces lividans | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9n0w | | Status: | HPUB -- hold until publication | | Title: | HTLV-1 Gag capsid from immature particles | | Authors: | Arndt, W.G., Ramezani, A., Chen, B., Perilla, J.R., Zhang, W., Mansky, L.M. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3s | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A10B10 glyceraldehyde-3-phospahte dehydrogenase from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F., Del Giudice, A. | | Deposition date: | 2025-01-24 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
| PDBID: | 9i3y | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND 17 | | Authors: | Walter, A., Atz, K., Stenzhorn, Y., Nippa, D., Grether, U., Kuhn, B., Martin, R., Benz, J. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4j | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the drug binding domain of AlbA in complex with the KMR-04-161 compound of the pyrrolobenzodiazepines class | | Authors: | Di Palma, M., Steiner, R.A. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9lpi | | Status: | HPUB -- hold until publication | | Title: | Neutron structure of GH1 beta-glucosidase Td2F2 glucose complex at room temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9mzv | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R. | | Deposition date: | 2025-01-23 |
|
