Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9m2t
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica complexed with AMP-PNP and glycerol.
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-28
PDBID:9qak
Status:HPUB -- hold until publication
Title:Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment G07
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-28
PDBID:9qb6
Status:HPUB -- hold until publication
Title:Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment H02 and CX-4945 (Silmitasertib)
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-28
PDBID:9qb0
Status:HPUB -- hold until publication
Title:Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment H07
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-28
PDBID:9qab
Status:HPUB -- hold until publication
Title:Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment E11 and CX-4945 (Silmitasertib)
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-28
PDBID:9qag
Status:HPUB -- hold until publication
Title:Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment F08 and CX-4945 (Silmitasertib)
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-28
PDBID:9qah
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment G04 and CX-4945 (Silmitasertib)
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-28
PDBID:9njm
Status:HPUB -- hold until publication
Title:hMCT1-BSGiso2-INX444
Authors:Lo, Y.-H., Dorsey, F.C.
Deposition date:2025-02-27
PDBID:9m21
Status:HPUB -- hold until publication
Title:GmMAN19-1 from Glycine max in complex with mannopentaose
Authors:Lin, C.J., Hsu, C.H.
Deposition date:2025-02-26
PDBID:9nj4
Status:HPUB -- hold until publication
Title:Fab1437 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-26
PDBID:9m20
Status:HPUB -- hold until publication
Title:GmMAN19-1 from Glycine max
Authors:Lin, C.J., Hsu, C.H.
Deposition date:2025-02-26
PDBID:9m1w
Status:HPUB -- hold until publication
Title:Crystal structure of N-prenyltransferase DsKabA
Authors:Huang, W.J., Hsu, C.H.
Deposition date:2025-02-26
PDBID:9niw
Status:HPUB -- hold until publication
Title:Fab1550 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-26
PDBID:9niy
Status:HPUB -- hold until publication
Title:Fab1393 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-26
PDBID:9q9t
Status:HPUB -- hold until publication
Title:Human ROCK2 in complex with a dihydropyrazolo-pyrimidine inhibitor
Authors:Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C.
Deposition date:2025-02-26
Sequence:

>Entity 1


GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
PDBID:9q9b
Status:HPUB -- hold until publication
Title:Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment C07 and CX-4945 (Silmitasertib)
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-26
PDBID:9q9c
Status:HPUB -- hold until publication
Title:Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D04
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-26
PDBID:9q9g
Status:HPUB -- hold until publication
Title:Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D10
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-26
PDBID:9q9d
Status:HPUB -- hold until publication
Title:Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D06 and CX-4945 (Silmitasertib)
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-26
PDBID:9ni1
Status:HPUB -- hold until publication
Title:Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-25
PDBID:9ni2
Status:HPUB -- hold until publication
Title:Fab369 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-25
PDBID:9nhy
Status:HPUB -- hold until publication
Title:Fab1502 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-25
PDBID:9q8r
Status:HPUB -- hold until publication
Title:Human ROCK1 in complex with a dihydropyrazolo-pyrimidine inhibitor
Authors:Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C.
Deposition date:2025-02-25
Sequence:

>Entity 1


GASFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
PDBID:9q8q
Status:HPUB -- hold until publication
Title:Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment E03
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-25
PDBID:9q8t
Status:HPUB -- hold until publication
Title:Nociceptive properties of U5-theraphotoxin-Hs1b, a novel peptide from the Cyriopagopus schmidti spider, active on NaV1.7 channel
Authors:Meudal, H., Landon, C.
Deposition date:2025-02-25

245663

數據於2025-12-03公開中

PDB statisticsPDBj update infoContact PDBjnumon