| PDBID: | 9m65 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the pathogen-secreted apoplastic GH12 xyloglucan-specific endoglucanase XEG1 | | Authors: | Xia, Y.Q., Liu, L., Zhang, Q., Shi, X.C., Wang, Z.K., Zhang, Z.C., He, X.Y., Xiao, J.H., Jiang, H.B., Zhang, S.C., Yang, Y.H., Ye, W.W., Wang, Z.Y., Wang, Y., Ma, Z.C., Yang, Q., Wang, Y.C. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9m5k | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from PD homogenate | | Authors: | Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5l | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from DLB homogenate | | Authors: | Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9qdk | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 in complex with fragment L330 and compound F46 | | Authors: | Landi, G., Mangani, S., Pozzi, C. | | Deposition date: | 2025-03-06 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 9qdo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the aromatic oligoamide foldamer binder Nanofitin C10 fused to a coiled-coil domain | | Authors: | Sigl, J.C., Morozov, V., Huc, I. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9qcr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | DNA-PK bound to 153 bp H2AX nucleosome model 2 | | Authors: | Hall, C., Chaplin, A. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9qcs | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ku80 mediated DNA-PK dimer bound to 153 bp H2AX nucleosome | | Authors: | Hall, C., Chaplin, A.K. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9qd3 | | Status: | HPUB -- hold until publication | | Title: | Gluthathion-S-Transferase StyI of Gordonia rubripertincta CWB2 | | Authors: | Burnik, J., Lienkamp, A.C., Hofmann, E., Tischler, D. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9m4m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human DHODH in complex with Lapachol derivatives, 511-12 | | Authors: | Pemba, M.C., Sakurai, Y., Kurosaki, Y., Amalia, E., Inaoka, D.K., Davey, A.R., Shiba, T., Kita, K., Yasuda, J. | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9m4o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human DHODH in complex with Lapachol | | Authors: | Pemba, M.C., Sakurai, Y., Kurosaki, Y., Amalia, E., Inaoka, D.K., Davey, A.R., Shiba, T., Kita, K., Yasuda, J. | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qch | | Status: | HPUB -- hold until publication | | Title: | Complex of Ovine Serum Albumin with Cephalosporin C | | Authors: | Duszynski, K., Talaj, J.A., Bujacz, A., Bujacz, G. | | Deposition date: | 2025-03-04 | | Sequence: | >Entity 1
DTHKSEIAHRFNDLGEENFQGLVLIAFSQYLQQCPFDEHVKLVKELTEFAKTCVADESHAGCDKSLHTLFGDELCKVATLRETYGDMADCCEKQEPERNECFLNHKDDSPDLPKLKPEPDTLCAEFKADEKKFWGKYLYEVARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIDAMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKADFTDVTKIVTDLTKVHKECCHGDLLECADDRADLAKYICDHQDALSSKLKECCDKPVLEKSHCIAEVDKDAVPENLPPLTADFAEDKEVCKNYQEAKDVFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEDCCAKEDPHACYATVFDKLKHLVDEPQNLIKKNCELFEKHGEYGFQNALIVRYTRKAPQVSTPTLVEISRSLGKVGTKCCAKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSDLTLDETYVPKPFDEKFFTFHADICTLPDTEKQIKKQTALVELLKHKPKATDEQLKTVMENFVAFVDKCCAADDKEGCFVLEGPKLVASTQAALA
|
|
| PDBID: | 9qcj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PhoC wild type acid phosphatase | | Authors: | Levy, C.W., Ortmayer, M. | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qci | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PhoC mutant acid phosphatase | | Authors: | Levy, C.W., Ortmayer, M. | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qcd | | Status: | HPUB -- hold until publication | | Title: | Micro-ED structure of the NSH2-CSH2 tandem domain of SHP2 in complex with the bis-phosphorylated pY627-pY659-Gab1 (613-694) peptide | | Authors: | Machner, L., Shaikhqasem, A., Hamdi, F., Breithaupt, C., Parthier, C., Kyrilis, F.L., Kastritis, P.L., Feller, S.M., Stubbs, M.T. | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9nli | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | GloR, native, unmodified | | Authors: | Cuthbert, B.J., de Miranda, R., Martinez, J., Goulding, C.W. | | Deposition date: | 2025-03-03 | | Release date: | 2026-03-03 |
|
| PDBID: | 9qbv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of WRN in complex with (R)-11 (GSK4766470) | | Authors: | Chaikuad, A., Concha, N., Chun, C.-W. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 9qbu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of WRN in complex with (S)-27 (GSK5819992) | | Authors: | Chaikuad, A., Chun, C.-W. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 7i24 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0016733-001 (A71EV2A-x1445) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 7i25 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0025240-002 (A71EV2A-x1778) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 7i27 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0018402-002 (A71EV2A-x2458) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 7i23 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0016618-001 (A71EV2A-x1346) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 7i26 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030304-001 (A71EV2A-x2304) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 9nla | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [CC-5x_Ag6] Tensegrity triangle structure with a C:C base pair hosting a templated 6-atom silver nanocluster | | Authors: | Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P. | | Deposition date: | 2025-03-02 |
|
| PDBID: | 9nkv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [CC-5x_Ag4] Tensegrity triangle structure with a C:C base pair hosting a templated 4-atom silver nanocluster | | Authors: | Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P. | | Deposition date: | 2025-03-01 |
|
| PDBID: | 9qb9 | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with a heparin-derived trisaccharide and the ATP-competitive inhibitor 4w | | Authors: | Werner, C., Harasimowicz, H., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-03-01 |
|
